KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0423Help
Entry
BLA_0423          CDS       T00819                                 

Gene name
gpm
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00010  Glycolysis / Gluconeogenesis
bla00260  Glycine, serine and threonine metabolism
bla00680  Methane metabolism
bla01100  Metabolic pathways
bla01110  Biosynthesis of secondary metabolites
bla01120  Microbial metabolism in diverse environments
bla01130  Biosynthesis of antibiotics
bla01200  Carbon metabolism
bla01230  Biosynthesis of amino acids
Module
bla_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLA_0423 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BLA_0423 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLA_0423 (gpm)
Enzymes [BR:bla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLA_0423 (gpm)
Membrane trafficking [BR:bla04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLA_0423 (gpm)
Exosome [BR:bla04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLA_0423 (gpm)
  Exosomal proteins of melanoma cells
   BLA_0423 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACL28725
UniProt: B8DW74
Position
529281..530216
Genome map
AA seq 311 aa AA seqDB search
MWPSGNTVAPCGICRGSRSPSRWCSSVSPCPSECAEIVAFADYPANRADMAMHVHLTRRV
ARLGHMTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKNGGKLMKDKGVLPDIVF
TSLLRRAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWR
RSYGTPPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARVEPYWEAEIIPELKSGKTV
LIAAHGNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDENFKPIKKGGEYLDPEAAAA
GAAAVAAQGQK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtggccaagcgggaataccgtagcgccatgcggaatctgtcgtggatcgcgctcgccg
tcgcgctggtgttcgtcggtctcaccatgtccatctgaatgcgctgagatcgtcgcgttc
gcagattatcccgccaatcgggcagatatggcaatgcacgtgcatttgactcgacgggtc
gctagactagggcatatgacttacaaactggtactgctccgacatggtcagagcgaatgg
aacaagacaaatcagttcaccggctgggttgacgtcccgctgaccgaaaagggccgcgag
gaagccaagaacggcggcaagctcatgaaggacaagggtgtgctgcccgacatcgtcttc
acctcgctgctgcgccgcgccatcaacaccgcgaacatcgcgctcgatgaggccgaccgc
ctgtggattcccgtgaagcgcgactggcgcctcaacgagcgtcactacggtgctctgcag
ggcaagaacaagaccgagatccgcgaggagtacggcgacgagaagttcatgctgtggcgc
cgctcctacggcaccccgccgcccgagattgacccgaacgaccagtacgcgcagaacaac
gacccgcgttacgccggcgacccggttccggaagccgagtgcctcgccgacgtcgtcgcc
cgcgtcgagccgtattgggaagccgagatcatcccggagctcaagagcggcaagaccgtg
ctcatcgccgcccacggcaattcgctgcgtgcgatcgtcaagatgctcgacggcctgacc
gaagaggagatcgccaaggtgaacatcccgaccgcgattccgctggtctatgagctcgac
gagaacttcaagccgatcaagaagggtggcgaatacctcgatcctgaggccgctgccgcc
ggtgccgccgctgttgcggcccagggccagaagtga

DBGET integrated database retrieval system