KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0475Help
Entry
BLA_0475          CDS       T00819                                 

Gene name
sulD
Definition
SulD protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLA_0475 (sulD)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BLA_0475 (sulD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BLA_0475 (sulD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594329..595198
Genome map
AA seq 289 aa AA seqDB search
MTTVDCSGIDLGSNEDDMRVWTADVSWVIDDDQLVDAEDLAAHVAAIGQMMLGVPVEQLA
ERIAAQLANQSVFRSVTVTVHMHWKAPLRTFEQLSATVTANRQSSANPSAAAANTGGEES
ASTHDGALPVDPSYRDAVISLHSAALNAEQLFREVIVTLDSMPGNQVDGISPLYFVGSLN
GTDGHAAVIKLSTAMGVRQLNQVLDALHTTHEGAVQLSVVATGKVGDESLHAPKGAADHH
LGAAVLEPWAAMDPNASYNGDPLAYLLAMAPDSAQVGVESERWVMGGGR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgtggactgcagcggcatcgacctgggcagcaacgaggacgacatgcgtgtg
tggacggcggacgtcagttgggtcatcgacgacgaccagctggtggatgccgaggatctg
gccgcacatgtggcggccatcgggcagatgatgctcggcgtgcccgtcgaacagcttgcc
gagcgcatcgcggcgcagctggcgaaccaatcggtgttccgctccgtcactgtcaccgtg
cacatgcattggaaggccccattgcgcaccttcgaacagctcagtgcaacggtcaccgca
aaccggcaatcctcggccaacccatctgctgccgctgcgaataccgggggcgaggaatct
gcaagcacgcatgatggggcattgccggtcgacccgtcataccgcgatgccgtcatttct
ttgcatagtgccgcgctgaatgccgagcagctgttccgtgaggtcatcgtcacactcgac
agtatgccgggcaaccaagtggacggcatctccccactgtatttcgtgggctccctcaac
gggaccgacggccatgccgccgtgattaaactcagcaccgcaatgggagtgcgtcagctg
aatcaggtgctcgatgcgctgcacaccacacacgagggagccgtgcagctgtcggttgtg
gccacaggcaaagtgggggatgaatcactgcatgcaccgaaaggtgcggcggatcatcat
ctcggcgctgccgtgcttgagccatgggctgccatggatcccaatgccagctataacgga
gacccactggcgtatctgctggcaatggcgcccgacagcgcacaggtgggcgtcgaatcc
gaacggtgggtcatgggaggcggccgatga

DBGET integrated database retrieval system