KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0619Help
Entry
BLA_0619          CDS       T00819                                 

Definition
glucosylceramidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLA_0619
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLA_0619
Enzymes [BR:bla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BLA_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(798417..799871)
Genome map
AA seq 484 aa AA seqDB search
MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTLSIDTTRVRQPIDGFG
ASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPSDHVSAPYRFVRRFPDR
NLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTR
ITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDYPQSRWPSMAMTPREQAEF
VARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMYADSAALTACAGSAWHYYGG
SARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLGTAVIDMMNNWARSAVLWNIA
LDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADYYALGHFSKYVPIGSRCVECAL
DHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLDLLCHLRGAGNGVMLTLPASSLT
SFLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgcttgccgccgcgttc
gcgccgcttgggaatgcctatttgcgtgtagggcgcacgccggagagcacgtcacacgcc
agcacccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc
gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga
tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca
atcggcccaagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc
aatctcaactccctcgatttcacacccgagatggagcgcgtgttgcccatggtcgaggcc
gcgaacgactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg
agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg
atcaccggccatctgcggcgcggcatgtatgccgcctatgcgcgctatatcaccggtttt
gcgcgattgtatgcgcagcgcggactgccgctgttcgcgctcaccgtgacgaacgaaccc
gactacccgcagtcgcgatggccatcgatggcaatgaccccgcgcgagcaggcagagttc
gtcgcgcgccatctgcgccccatgctcgaccacgccggattggaaggcacgcgcattctg
tgctgggaccacaactactccaccgaccattatccggacggcgccttcgtgcgagacatg
tacgccgattccgccgcgctcaccgcctgcgccggctccgcatggcattattacggcgga
tccgcgcgcacgatgtctcgcattcacgacgcgtttccgaacaagggcatctgggcgacc
gaggcgagcggcggcgactgggggccgcgcaatttcacacccgcgctgctctcgctgggc
acggcggtcattgacatgatgaacaactgggcgaggagcgccgtgttgtggaacatcgcg
ctcgacgagcacggcggtcccgactactactacctgcgcaacgatcgccggcattccgag
aaccgtggtctgatcactgtgcgtgacgacggttcgatacgccgcaatgcagactactac
gcgctcggccacttctccaaatacgtgccgattggctcacgttgcgtggaatgcgcgctc
gaccatgcgcaaggtgtgcgtgccgccgccttcctagtccctgccgctcttactcatggt
gatggtgaccaggttgttgccgtgctcgtgaactctcgccccgagccgctcgacctgctg
tgccatctgcgcggtgcaggcaacggcgtgatgctgacattgccggcttcctccctcacc
tctttcctggcatga

DBGET integrated database retrieval system