KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0694Help
Entry
BLA_0694          CDS       T00819                                 

Gene name
rbsK
Definition
sugar kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLA_0694 (rbsK)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLA_0694 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891591..892559)
Genome map
AA seq 322 aa AA seqDB search
MNQILDKLEQIHGSVSVVGSMNADYTVTTERLPGPGETVTGGPLQVLPGGKSGNQAAAAA
KLGATVRMFGAVGSDSNADFLLTQLASAGVNTDGIRKVLGPSGTTVITVDSHGENTIVYS
PGSNANVTVEYIESQRDLLTASSVLGLCLESPLETVTACATMCHDAGMKVLLNDSPFIAT
LPSELIAHADILLVNEHELVQLLHIDEPEDDDWDSFDWAQAQNRLSEFGFDQAIVTLGGD
GSVVLDSTVDPSIIRIAPVRVDAVDTTGCGDSFMGTVLASLASGLSLEESAQLASYVSAY
AATGYGAQASYGTAAQIRERFR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagattctcgataagctggagcagattcacggatccgtctccgtggtcggttcg
atgaacgcagattacacggtgaccaccgagcggctccccgggccgggggagaccgtgacc
ggcggcccgctacaggtgctgcccggtggcaaatcgggcaatcaggccgccgctgccgcc
aagctcggcgccaccgtgcgcatgttcggtgcagtgggctccgactcgaatgcggatttc
ctgctgactcagctcgcatccgccggagtgaacaccgatggcattcgcaaggtgctcggc
cccagcggcacgacggtgatcactgtggattcccatggcgagaacaccattgtgtattcg
ccgggttccaacgcgaacgtgacggtggaatacatcgaatcccagcgcgatctgcttacc
gcatcgtcggtgctgggactgtgtttggaaagcccgcttgaaacagtgaccgcatgcgcg
accatgtgccatgatgcgggtatgaaggtgctgctcaacgattcgcccttcattgcgacg
ttgccgtccgaactcattgcgcatgccgacattctgctggtcaatgagcatgagctcgtg
cagctgctgcacattgacgagcctgaagatgatgactgggattcgttcgattgggcacag
gctcagaaccgtttgagcgagttcggttttgatcaggcgattgtgacgcttggcggcgac
ggttcggtggtgcttgactccacggtggatccatcgatcatccgcattgccccggtgcgt
gtggatgcggtggataccacgggctgcggcgattcgttcatgggcactgtgctggcttca
ttggccagtggactgagcttggaggagtccgcgcaactggcttcgtatgtgtcggcatat
gcggccaccggctatggtgcgcaggcctcctatggcaccgccgcgcagattcgggagcgc
ttccgctaa

DBGET integrated database retrieval system