KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0881Help
Entry
BLA_0881          CDS       T00819                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLA_0881
  Lipid metabolism
   00561 Glycerolipid metabolism
    BLA_0881
   00600 Sphingolipid metabolism
    BLA_0881
Enzymes [BR:bla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BLA_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1123912..1126308)
Genome map
AA seq 798 aa AA seqDB search
MLEHSRPALLDELTAPRNALKPDSKGRIVWGNGTVTLVFAVSDDRPVTLIGMSGRGMEPV
DANIAGEPDAQPIVELRSSLDGGGDNRLKLAVSSAGLKLRFVRAYELNRLGDERQPVTLL
AIVQRDPDGDGPLVTSVFEATAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEAAKLED
AQAQVYWGESSWDCENAWQSAPLRSTTLRDRNQVINPGMSSARFARRSTSTWSTGEFEPM
GIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFIMLRDNQ
PFVTVPVSFVVCAGDWQHAVAEMTVQRRALYRAKAMEMGRLEQAEQAKGLVVYNDYMNTL
WGDPRIEKELPLVEGAAKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSMNRFGDIRLAGL
IHDIQSHGMKAGLWLEPEVIGVRSPLAKMLPDSAFFCRHGVRIADQGRYHLDFRSPVARA
HATATVDRLIDEFNVRFFKFDYNTTPGAGTDVDTDSVGEGLLEHCRAVQQWIEQIRAKHP
DVMIENCGSGAMRADYAMLSRLDMQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQQ
EMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPCG
LPDFNSPWLVYGLRHAPNVTGLSHDEDWNGTDGQGSEHVDEAQYLTIWRRGGINSLYLEI
GEGAHIEQVFPNPAKPEHAPDAKPWRIEWADSETVRIEASADKEPSARVFAITFPQPSAD
GTADDDASENAGHDIEGR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatagccgccccgcattgttggacgagttgacggcgccccgcaacgccttg
aagccggattcgaaagggcgcatcgtatggggcaacggaacggtgacgctcgtcttcgcc
gtgagcgacgacagaccggtgacattgatcggcatgagcggccggggcatggagccggta
gatgcgaacatcgccggcgaaccggatgcgcagccgatcgtggaactgcgcagttcgctt
gacggcggcggggacaacagactgaagctcgccgtttcgtccgccggcctcaaactgagg
ttcgtgcgggcatatgagctcaacagattgggcgatgagcgacagccggtcacgctgctc
gcgattgtgcagcgcgacccggacggggacggcccgttggtgacgagcgtgttcgaggcc
acggcgcacacgagcgccgtgcgcacctacacacggttgtgcagcgaggagccatatcca
gtggaggcggtgtcgtcgatgaacgcaacactgcccatggaagcggccaaactggaggat
gcgcaggcgcaggtctattggggagaaagctcgtgggactgcgagaacgcctggcaaagc
gccccgctgcgttccaccacgctgcgcgaccgcaaccaggtgatcaatccgggcatgtcc
tccgcccgattcgcccgccgttccacctcgacgtggtccaccggcgaattcgagccgatg
ggcatcgtcgaaggaggcggccgcccgggtgagctcggccatttctcattcgcatggcag
atcgagcacaacggcgcctgggaatgggagatcggcgaggacgacccgggtctgcgcgtg
agcgcatacgggccggaatacgacgaccatcagtggttcatcatgctgcgcgacaaccag
cccttcgtcacggtgccggtctcgttcgtggtctgcgcgggcgactggcagcatgccgtg
gccgagatgaccgtgcagcggcgcgcgctctaccgggcgaaggccatggagatggggcgt
ctggagcaggccgaacaggcgaagggtctcgtggtctacaacgactacatgaacacgttg
tggggagacccccgcatcgagaaggagctgccgcttgtggagggcgcggccaaggtgggc
gccgacgtgttctgcatcgacgccgggtggtacgacagcgaggacggcggctggtgggac
atggtgggtgaatggaaaccctccatgaaccgcttcggcgacatccgcctggccggcctc
atccacgacatccagtcacacggcatgaaggccggcctgtggctggagccggaggtgatc
ggcgtgcgctcgccgctggcgaagatgctgcccgactcggcgttcttctgccggcatggc
gtccgcatcgccgatcagggccgctaccatctcgacttccgctcgccggtggcgcgcgcc
catgccacggccacggtggaccgcctgatcgacgagttcaatgtgaggttcttcaagttc
gactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgagggc
ctgctcgagcattgccgcgcggtgcagcagtggatcgagcagatccgcgccaaacacccc
gacgtgatgatcgaaaactgcggttccggtgccatgagggccgactatgcgatgctgagc
cgcctcgacatgcagtccacctccgaccagtccgatccactcgtctatgcggcgatcgcc
gccggcgccggcatgacggtgcttccggagcagcagggcaactggggctatgcacagcag
gagatggacgacgagaccgccgtgttcacgctggctgcaggcattctgggccgcctgtac
ctctcggggttcatcgaccgcatggacgaggcgcggctgggcctggtgcgcgatgcgatc
gcactgcaccgcacgatcctgggcgggcaatcgcatctggtgccatggtggccctgtggg
ttgccggacttcaacagcccttggctcgtgtatggtttgcggcatgcccccaatgtgacc
gggctgtcgcatgacgaagactggaatggcactgacggccaaggctccgagcacgtcgat
gaggcccaatacctgaccatctggcgtcgtggcggcattaattcgctgtatttggagatt
ggtgagggagcccatatcgagcaggtgttccccaatccggccaagccggagcatgcgccc
gatgccaagccgtggcgcattgaatgggcggattccgagaccgtgcgcatcgaagcctcc
gcagacaaggagccctccgcacgtgtcttcgccatcacattcccgcagccatctgccgat
ggcacagcggatgacgatgccagcgagaacgccgggcacgatatcgaggggcgataa

DBGET integrated database retrieval system