KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1311Help
Entry
BLA_1311          CDS       T00819                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLA_1311 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLA_1311 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLA_1311 (trpA)
Enzymes [BR:bla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLA_1311 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646089..1646958
Genome map
AA seq 289 aa AA seqDB search
MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGFPTMEQSLEAFATMVE
NGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVETVANAGGVPLIMSYWN
LIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTDERLR
VVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAENVCVGIGVSTAAQGKAVG
QYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELAEGIHNARL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatacaacaccacgccaagcggtcagccgcttggaatcagccatcgtcccagc
ccatgccgcgagctgttcacacggttcaaagcgcaggacaagcctgcattcattgggtac
ctgccattcggattccccacgatggaacagtcactcgaggccttcgccacgatggtcgag
aacggtgctgacattgtcgagataggactgccgtattccgatccggtgatggatggcccg
gtgatccaggccgccagccagatcgccctgaacaatggcgagcgcatagccgatgtgttc
aaggccgtggagacggtggccaatgccggtggagtgccgctcatcatgagctactggaac
ctcatctaccattatggggttgaacgcttcgccgctgatttcgcgaatgcaggaggcgca
ggccttatcactcccgatctcattcccgacgaggcaggggagtggatcgaggcgtcggac
cgccatgggctcgatcgcatcttccttgtttcccccgactccaccgatgagcgtctgcgg
gtggtgtgtgaaaacgcccggggattcgtctatgcggcatcgcgcatgggcgtgactggc
gaacggtcgagtctagggacttccccggaggatcttgtggcccggacccgtaaggccggg
gccgagaatgtgtgtgtgggcatcggcgtctccaccgctgctcaaggcaaggccgtcggg
cagtatgcagacggggtcatcgttggatccgccttggtccacaccctgctcaccgaggat
ggcgatgcgcgcgagctcacctcaggtctggctgcgttggcggccaagaccgcagaactc
gccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system