KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1330Help
Entry
BLA_1330          CDS       T00819                                 

Gene name
ugpA
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLA_1330 (ugpA)
   00052 Galactose metabolism
    BLA_1330 (ugpA)
   00500 Starch and sucrose metabolism
    BLA_1330 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    BLA_1330 (ugpA)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLA_1330 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1662151..1663578)
Genome map
AA seq 475 aa AA seqDB search
MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWQHEDGTTWIREEDIEPVQDIPNFAQIYE
TINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAKQMRFIDIILGQVETAR
NRLGVELPLTFMNSFRTSADTMKVLNRDKRFHQDDIPMEIIQHVEPKIDLSTGEPVSFPS
NPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDNLGARPSRTLAQHFENTDA
PFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDAAEAKNIDKHPYFNTNNIWV
RIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTEVIQLETAMGAAVSLFNGAICVEVD
RMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNVQLDTRFYKNIHDFDDRFPYGV
PSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYVPNGEFVGPQGIEPDEWL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcgagcgaaccgccgagaagatgaaggcccacggcctgagcgagacg
gccatagcccaattcgagcatctctatgatgtgtggcagcacgaggacggcaccacttgg
attcgcgaggaggacatcgagccggtccaggacattcccaatttcgcgcagatctatgag
acgatcaaccacgacaaggcggtcgacgcattcgccaagacggcgttcctcaagctcaac
ggcggtctgggaacctcgatggggctcgactgcgcaaaatcattgttgccggttcgcagg
cacaaagccaagcaaatgcgcttcatcgacatcattctcggacaggtggaaaccgcacgc
aaccgactgggcgtggagctcccgctgacgttcatgaactcgttccgcacatcggccgac
accatgaaggtgctcaaccgagacaagcggttccatcaggatgatattccgatggagatc
atccagcacgtggagcccaagatcgatctttcgacgggggagccggtgtcattcccctcc
aatcccgatctcgaatggtgcccacccgggcacggcgacctgtattcgaccctctgggaa
tcgggtctgctcgacattctcgaaagccacggattcaagtacctgttcatctcgaactca
gacaatctgggggcacgtccgtcacgcactctggcccagcacttcgaaaacaccgacgct
ccgttcatgatcgaagtgtcgaaacgcaccgaagcggatcgcaagggtggtcacatcgtt
cgcgacaaggtcaccggtagactcatgttgcgcgagatgacgcaggtggcccctgaagac
gcggcggaagccaagaacatcgacaagcatccgtatttcaatacgaacaacatctgggtg
cgcatcgactccctacgcgagaagctggcacagagcaacggcgtgctcccgttgcctgtc
attcgcaattacaagaccgtcgacccaacggatgcctccaccaccgaggtgattcagctc
gagaccgcgatgggcgctgcagtgagtctgttcaatggggcgatctgcgtcgaggtggac
cgcatgcgcttcctgccggtgaaaaccaccgacgacctgttcatcatgcgctccgaccgc
ttccatctgaccgatcagtacgagatggaggacggcaactacatcttcccgaacgtccag
cttgacacgcgcttctacaagaacatccatgatttcgacgaccgcttcccctacggcgtg
ccatcgcttgcagcggctgcctcggtcacggtggagggggattggaccttcggccgtgat
gtgaacttctatggtgaggcgacattgcatgatgagggtaggccgagttatgtcccaaac
ggcgaattcgtaggaccgcagggtatagagcccgacgaatggctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system