KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1448Help
Entry
BLA_1448          CDS       T00819                                 

Gene name
aroB
Definition
bifunctional shikimate kinase/3-dehydroquinate synthase
Orthology
K13829  
shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bla01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bla00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1796239..1798173)
Genome map
AA seq 644 aa AA seqDB search
MAHNHRHAGKPRRQPQAVIIGMMGAGKTRLGKEMAQMRGLPFLDADVEIEREIGMSIPDY
FAQYGEPAFREVERDVVCDILDSFGGIFSLGGGAPMTKAIRRRLAQYVARGGKVVYLKAD
PHEAMERANRGGGRPMLTGDAEKRWMSLFRQRDPVYRQVANLVVPTRGMTPKAAAKRMIE
MVAEHTVHVDGRGIEPYDVRIGEGALSHLPEVLGKQPVRVALIHTQSVQRHSDRARGLLR
QAGYEVSDIVIPDAEAGKTIEVANGIWQRLGTEGFTRSDAIVGIGGGACTDLAGFVAATW
MRGIRYVNCPTSLLAMVDASTGGKTGINTPQGKNLVGSFYTPAGVLADLRTLTTLPNDIF
IEGLGEVAKSGFIMDPQILRILEDHAAELRAFSGETFLGTPLEDVVSELIERTVRVKAHH
VSADLREAGLREFLNYGHTFGHAIEQLEHFRWRHGNAVAVGMVYAAELSSLTGHLDRDTV
DYTRSLLTSLGLPTSWNGAGFDEVLALMHRDKKARGNTLRFVGLEQVGEPFHLNDPDSEA
GRGRPSTVCRTREWNRSGRCEVNIRPECKVGADHPYTLRPRYSGEQPTATNWRDNGNEVT
ADQGHGGQWAESGAARSASAGCVRFAGSRGAASTLHPVGGRIRP
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcacataaccacaggcacgcgggcaaaccccgcaggcaaccgcaggccgtgatcatc
ggcatgatgggtgcgggaaagactcgactcggcaaggagatggcgcagatgcgcggtctg
ccatttctcgacgccgacgtggagatcgaacgcgagatcggcatgagcataccggactat
ttcgcacaatatggggaaccggcatttcgcgaggtggagcgtgatgtggtgtgcgatatc
ctggattccttcggcggcatcttttccctgggaggcggagcgccgatgacgaaggccata
cgtcggcgcctggcacagtatgtggcccggggcggcaaggtggtgtatttgaaggccgac
ccacatgaagccatggaacgtgccaaccggggaggcggtcgccccatgctcacaggcgat
gccgagaaacgctggatgtcgctgttcagacaacgcgaccccgtataccgtcaggtggcg
aatctggtcgtgccaacgcggggtatgacgcccaaagccgcggcgaaaaggatgatagaa
atggttgcagagcacactgtacatgttgatggcaggggaatcgaaccctacgatgtgcgc
attggggaaggagcgttgagccacctgcctgaagtgctgggcaagcagcccgtgcgcgtg
gcgctcattcacacgcagtccgtgcagcgccatagcgaccgtgctcgcggactgctgcgt
caggcaggttatgaggtatcggacattgtgattcctgacgccgaggccggcaagaccatc
gaggtggccaatgggatctggcaacggctgggcacggagggcttcacccgttcggatgcc
attgtgggcatcggcggtggggcctgcacggatttggcaggattcgtggcagccacgtgg
atgcgcggcatccgctacgtgaactgccctacgtcgctgctcgccatggtggacgcctcc
accggtggcaagaccggcatcaacacccctcaaggcaagaacctggtcggttcgttctac
acgccggccggcgtgctggcggacctccgcacgttgaccacgctgcccaacgacatcttc
atcgaagggctgggcgaggtggcgaaatccgggttcatcatggatccgcagatcctgcgc
atcctcgaggaccatgccgccgaactgcgcgcgttcagtggcgagacattcctgggcacg
cctctggaggatgtggtcagtgagctcatcgagcgcaccgtccgtgtgaaggcccatcat
gtgagcgcagatctccgggaggccggattgcgtgaattcctcaactacggccacaccttc
ggtcatgcaatcgaacagctcgagcatttccgctggcgtcacggcaacgccgtggccgtt
ggcatggtctatgccgccgagctgtcgagcctgaccgggcaccttgaccgtgacacggtg
gactacacaaggtctctgctcaccagcctcggtctgccgacatcgtggaacggcgccggc
ttcgatgaggtcctcgcattgatgcatcgtgacaagaaagcccgtggcaacacgctgcgg
ttcgtgggccttgaacaggtgggggagccgttccatctgaacgaccccgattcggaggcc
ggtagaggaaggccttccaccgtgtgcagaacccgtgaatggaatcggtccggcaggtgc
gaggtgaatatacgcccagaatgcaaagtgggagccgaccacccatacacgctccggcct
cgctatagtggagagcagccaacggcaacgaattggagggacaatggcaacgaagtcaca
gccgatcaaggtcatggtggtcaatgggccgaatctggggcggctcggagtgcgtcagcc
ggatgtgtacggttcgcaggatctcgaggagctgcgtcgactctgcacccggtggggggt
cgaatacggccttga

DBGET integrated database retrieval system