KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1208Help
Entry
BBMN68_1208       CDS       T01345                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1437996..1438913)
Genome map
AA seq 305 aa AA seqDB search
MVKNIAYATEEETLMGNGVNLRTLTNDGGSAVISDYGAHLLRWAPAGQPDVIWTPRTWHF
EAGQPVGGGVPVCFPWFGPGFVHGGQTAKRPIHGFARLRQWALDEGAFTGARVRYVLDSE
RLTTGEVPWIEDEPNVRFHAAYEVCASDTLTMTLTVTNTGGEPMSYEAALHSYLHVGDVL
GARLVGLRGATYLDATEAGFPPKLQEQPSVMFGDQPVDRVYYSDAALELQDHVLGRVIRI
GKTGSPQTVVWNPGEQGGNAIAHAKTGEWRGFVAVEAAACRDRIVALSPGESYMLSQSIA
VMPLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaagaacatcgcttacgcaacggaagaagaaacacttatgggcaatggcgtcaat
ctgcgcacgctcaccaatgacggcggtagcgcggtaatcagcgattacggggcgcatctg
ctgcgctgggccccggcggggcagccggatgtaatctggacgccccgcacatggcatttc
gaagctggtcagccggttggcgggggagtgccggtgtgcttcccctggttcgggccgggg
tttgtgcatggcgggcagactgcgaagcgaccgattcatgggttcgcgcgattgcgccag
tgggcgctggacgaaggggcgtttaccggtgcccgtgtgcggtatgtgctggattccgaa
cgactgacgactggcgaagtgccatggatcgaggatgaacccaacgtgcgtttccatgcc
gcatacgaggtgtgtgccagcgatacgctgacgatgacgctgaccgttaccaacacggga
ggtgagccgatgtcgtatgaggcggcgctgcactcgtatctgcatgtcggcgatgtgctc
ggcgcgcggctggtcggtttgcggggtgcaacatatctggatgccacggaagccggattc
ccgccaaaactacaagaacagccatcggtgatgttcggcgatcagccggtggaccgtgtg
tattattccgatgctgcactggaattgcaggaccatgtgctgggtcgtgtgattcgcatc
ggcaagaccggctcgccgcagacggtggtgtggaatcccggagagcagggcggcaacgcc
attgcccatgccaagacgggtgaatggcgtggctttgtggccgtggaggcagcggcgtgc
cgagaccgtatcgttgcccttagtccgggtgaatcgtatatgctttcgcagtccattgcc
gtgatgccgttggggtag

DBGET integrated database retrieval system