KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1232Help
Entry
BBMN68_1232       CDS       T01345                                 

Gene name
recR
Definition
recr
Orthology
K06187  
recombination protein RecR
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBMN68_1232 (recR)
DNA repair and recombination proteins [BR:blb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BBMN68_1232 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1468578..1469180)
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYHGLYHVLGGAINPMANVG
PADLRIPGLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacaacgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatttggccgaggccatcgaagaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggtcgaagagcccaaggatgtgatgagcatcgagcgcacgcgc
gaataccacggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccggtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtgattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtatgccgacgaaatcacgctgggcagggcactggccggtcggcgcgaggcc
taa

DBGET integrated database retrieval system