KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1267Help
Entry
BBMN68_1267       CDS       T01345                                 

Gene name
treY
Definition
trey
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1509638..1511152)
Genome map
AA seq 504 aa AA seqDB search
MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDPRLGGWDDVAELSKTHGIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLNTGHVEPVAHWTDIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNAIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGKNDMELLRKTNNGRDINRHYYSTAEIDENLQRPVV
KALNALAKFRNELDAFDGTFSYSADGDTSISFTWEGTTTQATLTFEPGRGLGVENTASVA
TLEWRDAAGEHRTDDLIANPPVVA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcatcacctacgccgatcgcctcggcgacggcaccctcagc
tcgatgaccgacatcctgcgcacccgtttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccattcgacggcgcggatgcaggcttcgaccccatcgaccacaccaag
gtcgacccgcgcctcggcggctgggacgatgtcgccgaactttccaagacccacggcatc
atggtcgacgccatcgtcaaccacatgagctgggaatccaagcagttccaagacgtgctt
gaaaagggcgaggaatccgagtattacccgatgttcctgaccatgagttccgtctttccg
aacggcgcgaccgaagaggatctggccggcatctaccgtccgcgcccgggtctgccgttc
acccactacaagttcgcgggcaagactcgcctggtctgggtcagcttcaccccgcagcag
gtcgatatcgacacggattccgacaagggttgggaatacctgatgtcgattttcgaccag
atggccgcatcccacgtcagctacattcgtcttgacgccgtcggctacggtgccaaggaa
gccggtaccagctgcttcatgacgccgaagacgttcaagctcatctcccgcctgcgcgag
gagggcgtcaagcgcggcttggaaatcctcatcgaagtgcattcctactacaagaagcag
gtcgagatcgcgtcgaaggtcgatcgcgtctacgatttcgcccttccgccgctgctgctg
cattcgctgaataccggtcatgtcgagccggtcgcgcattggaccgacatccgtccgaac
aatgccgtcaccgtacttgacacgcatgatggcatcggcgtgatcgacatcggttccgat
cagctggaccgttcgctcaaggggctcgtgccggatgaggatgtcgacaatctcgtcaac
gccattcatgcgaacactcacggcgaatcgcaggccgctaccggtgccgccgcatccaat
cttgacctgtatcaggtcaacagcacctactattcggcgctgggatgcaacgatcagcac
tatattgcggctcgcgcggtgcagttcttcctgccgggcgttccgcaggtctactatgtc
ggcgcgcttgccggcaagaacgacatggagctgctgcgcaagaccaacaatggccgcgat
atcaatcgccattactattccacggctgagatcgacgagaatctgcagcgtccggtggtg
aaggcactgaacgcgcttgccaagttccgcaacgagcttgatgcgttcgatggcaccttc
tcgtacagcgccgacggcgatacgtccatcagcttcacgtgggagggcacgaccactcag
gccacgctcacgtttgagccgggccgtggtcttggtgtggagaacaccgcgtccgtcgcc
acgctcgaatggcgtgatgccgccggtgagcaccgcacggacgatctgatcgccaatccg
ccggtcgtggcctga

DBGET integrated database retrieval system