KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1310Help
Entry
BBMN68_1310       CDS       T01345                                 

Gene name
pldB
Definition
pldb
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBMN68_1310 (pldB)
Enzymes [BR:blb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BBMN68_1310 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562563..1563654)
Genome map
AA seq 363 aa AA seqDB search
MQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAGIEPLSGIMDTGGRSGQLH
YLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEHRGH
GKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAVLER
YPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGKKRVFGQSGFTPEFSMEGNEG
ASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRAILNPSACAEVETPVLLFQSGRD
IWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPMIAC
AAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgaccgacgtggtgctg
cccgcgctcgaacaatgctgcgaggagggctggttcgatccgtccgccgccgaacgttcg
gccgggatcgagccgctgtccggcattatggacaccggcggccgctcgggccagctgcac
tacctgtgctacgactccgccaaattcgacgcgattcgcgagcaaggcgccaccgccacc
ttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgaaaagtacgacgag
ctcgtctggtacttcctgcttgccggctactcggtgtgtgtactcgagcatcgcggccac
ggcaagtccgcgcgcgacgtggacaaccgctgcatggtgtggattgatgactggcagcgc
tacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcggccggcatg
ccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccgtgttggagcga
taccccaccctgttcgacaaagcggtgctctctgccccgatgatcgcccccgccaccggc
atgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggcttcggcaag
aagcgcgtgttcgggcagtcgggcttcacgccggaattctcgatggaaggcaacgagggc
gcttccgaagcgcgtgaacgctggtacttcaagctgcgttgcgagaatagcgaataccag
acctactgcgcggcgttcgaatgggtgcgccaagcgttgaagctcaaccgggccatactg
aatccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtccggacgcgac
atctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggacggcggcggc
gaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatgcccaacagc
acttacaagccctacctcgaaaagatcctcggcttctacgacgaccccatgattgcctgc
gccgcgtactga

DBGET integrated database retrieval system