KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1363Help
Entry
BBMN68_1363       CDS       T01345                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBMN68_1363
   00500 Starch and sucrose metabolism
    BBMN68_1363
Enzymes [BR:blb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BBMN68_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628064..1629650)
Genome map
AA seq 528 aa AA seqDB search
MNAGTILYIPVAQAEGGATVTVKGQLYGPTLKLDGTDITTGTAVTIATDSTRYVPLSVEG
TGSLYLTGIAIDYAAGSPAATSHTVTVGPNGQYRTIQAALDANDSSETDRLVLKITPGDY
REKITVTKPGVTFANADVTAKRAVTIRASYYSSNTFDADGKFVPQDEFDLGTNKCATVTI
GAGATGFSAYGITFQNDYNVVDHTAAGEQTPAVALNTQADKVYLKNSRIIGRQDTLYVQG
AGNRVYVDGGYIEGTVDFVFGDANAYFAGTELHMAAFAGKNNGYFTAANTKKSGVGLVFD
RCNLTVAAAYDDDAKLSLGRPWQTFAQYTQVRKGDGSSYVTGVDLGTKNSAYTDTSSAVT
YLDSTMSSKITKNRWNVWTSKNQSGKSVDVTFHDDVRFAEYASHDETGALLDPADYKNVV
LGSMSALDEAQVQAKRAELLAALGFGSAAGQWVVPDGAWPFAYDPNYSTGTDVQPTQPGG
NASPNADSAAKADTMPETGSAIIAVVVVAVPLLVAGLALVAVRRNRQQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctggaaccatcctgtacattccggtcgcacaggccgagggcggcgctacagtc
accgtgaagggccagctgtacggtcctacgctcaagctcgacggtacggacatcaccacc
ggcactgctgtaaccatcgcaaccgacagcacgcgctacgtgccgctctccgttgaaggc
acgggcagcctgtacctgaccggcatcgccatcgactacgcggccggctcccccgccgcc
accagccacacggtcaccgtgggcccgaacggccagtaccggaccattcaagccgctctg
gatgctaacgactcttccgaaaccgaccgactagtgctgaagatcactccgggcgactat
cgcgagaagatcaccgtgaccaagccgggcgtcaccttcgccaacgccgacgtgaccgcc
aagcgcgcggtgacgattcgcgccagctactattcgtccaacacattcgatgccgacggc
aagtttgtgccgcaggatgaattcgaccttggcaccaacaagtgcgccaccgtgaccatt
ggcgcgggtgccacaggtttctccgcctacggcatcaccttccagaacgattacaacgtg
gtggatcacacggcggcgggcgagcagacgccggccgtggcgctgaacacccaggcagac
aaggtgtacctgaagaacagccgcatcatcggccgtcaggacactctgtacgtgcagggc
gccggcaaccgcgtgtacgtggacggcggctacatcgaaggcacggttgatttcgtgttc
ggcgacgccaacgcctacttcgccggcaccgagctgcacatggccgcgttcgccggcaag
aacaacggctacttcaccgccgccaacaccaagaagtccggcgtgggcctggtgtttgac
cgctgcaacttgaccgttgccgcagcatatgacgacgatgccaagctttcgctgggccgc
ccgtggcagacgttcgcgcagtacacgcaggtgcgtaagggcgacggcagcagctatgtg
accggcgtggatttgggtacgaagaactcggcgtatacggacacttcctcggccgtgacc
tacctcgacagcacgatgtccagcaagatcaccaagaatcgttggaatgtgtggaccagc
aagaaccagagcggcaaaagcgtggacgtgaccttccacgatgatgtgcgattcgcggaa
tacgccagccacgatgaaaccggcgcgctgcttgatccggctgattataagaacgtcgtg
ctcggctcgatgtctgctttggatgaggctcaggtgcaggcgaagcgtgctgaattgctc
gcggcactgggcttcggctcggcggctggtcagtgggttgtgccggatggcgcgtggcca
ttcgcttacgacccgaactactcgaccggcactgatgtgcagccgactcagccgggcggc
aacgcctcgcctaacgcggattcggcggccaaggccgacaccatgccggaaaccggctcg
gccatcattgcggtggttgtagtcgccgtgccgctgctcgttgctggcttggcgctggta
gcagtgcgccgcaatcgccagcagtga

DBGET integrated database retrieval system