KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1387Help
Entry
BBMN68_1387       CDS       T01345                                 

Gene name
ispE
Definition
ispe
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:blb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1659122..1660072)
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRPAAARHQFDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTIYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDIVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIEVWRDTAVVDR
IIRAKSPEHPNISVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgcccagccgctgcccgacatcagttcgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtggga
cctgctcacgacgaatggggcggacgccacgaactggacaccatctactgcgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcaggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcccatagagcgcctgcgcacc
attgctgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcataccagtcgcaactcagcact
cctgaggtctaccacacctttgacatcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgaggtgtggcgcgatacagctgtggtcgatcgt
attattcgagccaaatctcccgaacaccccaatatcagcgtcagacagtga

DBGET integrated database retrieval system