KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_143Help
Entry
BBMN68_143        CDS       T01345                                 

Gene name
dxr
Definition
dxr
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBMN68_143 (dxr)
Enzymes [BR:blb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BBMN68_143 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161961..163151
Genome map
AA seq 396 aa AA seqDB search
MSIASNSTVIILGSTGSIGTQGLDVISRHPERFTVTGLAAGGAHIELLAQQAAQFHVSEV
AVFDETKVPALQAALAQAGAQGVRVTGGPDSVIAMAGSGANVVLNGITGSIGLEPSIAAL
KAGSQLALANKESVVAGGHLLFSAQVRENQINPVDSEHSAIWQSLRSGTHAEVAKLVVTA
SGGPFRGWKRADMENITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFNVPPER
IDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMTNVAAACDWTQAATW
TFEPLDDEAFPAVQLARHCLAASEKHTAVLNAANEQAVHAFLEHRLPYLGIVDTVKAVLD
QMDAELRGNPLFTDVEEMNQLELEARRRADDLINKQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatagcctccaactccactgtcatcattctcggatccaccggatccatcggcacc
caaggacttgacgtcatctcgcgtcatcctgaacgatttaccgtcaccggtctggcggcg
ggcggagcacatatcgagctgctggcgcaacaggccgcacagttccatgtgtccgaagtc
gcggtgtttgatgagaccaaggttccagcgctgcaagcagctctcgcacaggccggcgca
caaggtgtccgcgtgaccggcggtccggattcggtcatcgccatggccggctccggtgcg
aatgtcgtattgaacggcatcaccggctccatcggactcgaaccgtcgatcgcggcgctc
aaggccggttcccagctggcattggccaacaaggagtccgtagtcgcgggcgggcatctg
ctgttcagcgcgcaagtgcgcgagaaccaaatcaacccggtcgattccgagcattccgcc
atctggcaatccctgcgctccggaacccacgccgaagtcgccaagcttgtggtcaccgcc
tccggcggaccgttccgcggctggaaacgtgccgacatggagaacatcactcccgagcag
gcgctgcatcatccgacgtggaacatggggccggttgtcaccatcaactcctccacactg
atgaacaagggcctcgaagtcatcgaggcgtcccgcttgttcaacgtgccgcctgaacgc
atcgacgtgaccgtgcacccgcagtccatcgtccattccatggtcgaatttgtggatggc
gccacgatttgccaagcttcgcccccagacatgcgtctgcccatcgcgctgggcctgtcc
gcgccggaccgcatgaccaatgtggccgccgcgtgcgactggacgcaagccgcaacttgg
acctttgaaccgttggacgatgaggcgttccctgccgtgcaactggcccgccactgcctg
gccgcctccgagaagcatacggcggtgctcaatgcagccaatgaacaggccgtgcatgcc
ttcctcgagcatcgtctgccatacctcggcatcgtggacacggtcaaagccgtgctggac
cagatggacgccgagcttcgtggtaacccgctgttcacggacgtggaggaaatgaaccag
cttgagcttgaagcccgccgacgcgccgacgacctgataaacaagcaatga

DBGET integrated database retrieval system