KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1437Help
Entry
BBMN68_1437       CDS       T01345                                 

Gene name
phoE
Definition
phoe
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBMN68_1437 (phoE)
   01230 Biosynthesis of amino acids
    BBMN68_1437 (phoE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_1437 (phoE)
  Energy metabolism
   00680 Methane metabolism
    BBMN68_1437 (phoE)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_1437 (phoE)
Enzymes [BR:blb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     BBMN68_1437 (phoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1743617..1744330
Genome map
AA seq 237 aa AA seqDB search
MSEQNVNGTVAVENSRGGNGFLVLLRHGQTVWSESGQHTGRTNIPLTAVGEQQAADAGRR
LREAFPEGFSQGCVFSSPLKRACQTAELAGFADHGVLDGIAEWDYGRAEGRTRQQVSEAS
GFEWDVWRDGPRSLTPTLEGDWVETLPSGEQVPVHAGPGETLEEAAVRAKSAIDEITPLL
KDGHNVLLVAHAHILRILTSQWLGVDPHFARLLRLDTAHYSVLSVYKGDNVIERWNA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacagaacgtgaacggcaccgttgccgtcgagaactctcgtggcggcaacgga
tttttggtgttgctgcgccacggccagaccgtgtggagcgaatccgggcagcataccggg
cgcacgaacatcccgttgaccgcggtcggcgagcagcaggcagcggatgccggaaggcgc
ctgcgcgaagctttccccgaaggattcagtcagggctgtgtgttttccagtccgctgaag
cgggcgtgccaaaccgctgaactggccggttttgcggaccacggtgtgttggacggcatc
gctgaatgggattatggccgagccgaggggcgtacgcgccagcaggtgagtgaggccagc
ggttttgaatgggatgtgtggcgtgacgggccgcgctcgctgacgcccacgctggagggc
gattgggtcgagaccttaccttcgggcgagcaggtgccggtccatgccgggcctggcgag
acgctggaagaagcagcggtacgcgccaagagcgccatcgatgagattacgccgctgctg
aaagacggccataatgtgctgttggtggctcatgcgcacatcctgcgcatcctcacctcg
caatggctgggcgtggacccgcatttcgcgcggttgctgcgtttggatacggcgcactac
tcggtgctcagcgtctataagggagataacgtcatcgaacggtggaacgcctag

DBGET integrated database retrieval system