KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1525Help
Entry
BBMN68_1525       CDS       T01345                                 

Gene name
murA
Definition
mura
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:blb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888965..1890290
Genome map
AA seq 441 aa AA seqDB search
MAENPDDVLHVEGGKPLNGTIKVRGAKNFVSKAMVAALLAPGKSVLKNVPEIRDVHVVSD
LLRLHGVDVDVDGANGIVTIDASRVQLADVADVDTLSGSSRIPILFSGPLVHRLGEAFIP
ALGGCAIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGLHGAKIHLPYPSVGATEQT
LLAAVLAEGKTELSGAATEPEIMDLVCVLQKMGAIISVDVDRTFRIEGVKELQGYTHTSL
TDRIEAASWASAALATHGDIFVKGATQPEMITFLNVFRKVGGKFEVTDKGIRFWHPGGDL
KPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYENRFGFTKPLVEMGATIQLYR
ECLGSLPCRFRQRNYKHSAVIFGPTPLTGRDIDVPDLRGGFSHLIAALAASGPSDVHGIS
LIDRGYADFRGKLEALGADFD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaatccggatgacgtgttgcatgtcgagggcggcaagcctttgaatggcacg
atcaaggtgcgtggcgcgaagaacttcgtgagcaaggcgatggtcgccgcgttgctggca
ccgggcaagtcggtgctgaagaacgtgccggagattcgtgacgtgcatgtggtgtccgat
ttgctacgtctgcacggcgtggacgtggatgtggacggtgcgaacggcattgtgaccatc
gacgcctcgcgtgtgcagctggccgatgtggccgacgtggatacactgtccggttcgtcg
cgcatcccgatcctgttttccggcccgctcgtgcaccgtttgggtgaagcgttcattccc
gcgttgggcggctgcgcgattggcggacgtccgattgacttccatctggagacgctgcgc
aagctgggcgccacggtggacaaggaacacaaggacggcatccacatcaccgcgcccaac
ggcctgcacggcgcgaagatccacctgccctacccgtcggtgggcgccaccgagcagact
ttactggcggccgtgctggccgagggcaagaccgaactgtcgggcgcggccactgagccg
gagatcatggatctggtgtgcgtgctgcagaagatgggtgcaatcatttctgtggacgtt
gatcgcaccttccgcatcgagggtgtcaaggaactgcaggggtacacgcacacgtcgctg
acggatcgcatcgaggcggcgtcctgggcgtccgccgcgctcgccacgcacggtgacatt
ttcgtcaagggtgccacccagccggagatgatcacgttcctcaacgtgttccgcaaggtg
ggcggcaaattcgaggtgacggacaagggcattcgtttctggcatccgggcggggacttg
aagcccgtggcgatcgagacggacgtgcatcccgggttcatgaccgactggcagcagccg
ctcgtggtggccctgacccaggccaacggcctgtcgatcgtgcacgagaccgtgtacgag
aaccgtttcggcttcaccaagccgctggtcgagatgggtgccaccatccagttgtaccgc
gagtgcctgggctcgctgccgtgccgtttccggcagcgcaactacaagcattccgccgtg
atcttcggaccgaccccgctgaccggacgcgacatcgacgtgccggacctgcgtggtggg
ttcagccatctgatcgcggccttggccgcgtcaggcccctcggacgtgcacggcatcagc
ctgatcgaccgaggctacgccgacttccgcggcaaactcgaagcgttgggtgccgacttc
gattaa

DBGET integrated database retrieval system