KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1543Help
Entry
BBMN68_1543       CDS       T01345                                 

Gene name
proB
Definition
prob
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:blb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913599..1914732
Genome map
AA seq 377 aa AA seqDB search
MSTPSQAEVRRMIAAAGTIVVKVGSSSLTQPSGHLDPDKLDALAAALAQVRLMGGRVVLV
SSGAIAAGFGPLGFDSRPVDVATQQATAAVGQGLLMARYETAFGRFGIRVGQILITAEDT
IRATQYRNVERTLDRLLDLGVVPIINENDSLASNEIRFGDNDRLSALVANLVRAEALVLL
TDVDALYTAPPSQPGSRRVEYVPNVIDALGDIQVSGSGSKVGTGGMVTKLEAARVAAVSG
IPTVLTCASNAGPAMMGDPVGTVFAPVKARGSSRRLWIGFAADPRGTIVVDAGAGQAIRG
GRASLLAAGALEVHGDFSAGDPVWIDAESGEHLGRGLAGFDSEEIPQMLGRNTAQLKRFL
GPQYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccgagtcaggccgaggtgcggcgcatgatcgccgcagccggaaccattgtc
gtgaaagtcggctccagctcgctgacccagccgagcggtcacctcgacccggacaagctc
gacgcgttggccgcggccttggctcaggtccgattgatgggcggacgtgtggtgctggtc
tcgtccggtgctatcgccgccggtttcgggcctctgggctttgactcgcggccggtggac
gtggccactcagcaggccaccgcagccgtcggccaagggctactgatggcccgctacgag
actgcgttcggtcgattcggtattcgcgtcggccagattctgatcactgccgaagatacg
attcgtgccacccagtaccgcaatgtggaacgcacgctggaccgtctgcttgacctcggc
gtggtgccgatcatcaacgaaaacgattcgttggcctcgaacgagattcgcttcggcgac
aacgatcgactctccgcgttggtggccaacctggtgcgggccgaagccttggtgctactg
accgacgtggacgcgctgtacactgcgccgccctcgcagcccggctcccgccgtgtggaa
tatgtgcccaacgtgattgatgcgctgggcgacatccaagtctccggctccggctccaag
gtcggcaccggcggcatggtcaccaaactcgaggccgcgcgcgtggcggccgtctcgggc
atccccacggtactcacctgcgcctcgaacgcgggccctgcgatgatgggcgatccggtg
ggcaccgtgttcgcaccggttaaggcccgcggctcctcacgccgtctgtggatcggcttc
gccgccgacccgcgcggcacgattgtggtcgatgcgggtgccggccaggcgattcgcggc
gggcgtgcctcgctgctagcggccggcgcgctcgaagtacatggcgatttttccgccggc
gatccggtctggatcgatgccgaaagcggtgaacacctgggccgaggcctcgccggcttc
gattccgaagaaattccgcagatgctcgggcgtaacaccgcccaactcaagcgtttcctc
ggcccccagtacgcccacccactggttcatcgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system