KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1612Help
Entry
BBMN68_1612       CDS       T01345                                 

Gene name
putA2
Definition
puta2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBMN68_1612 (putA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_1612 (putA2)
   00620 Pyruvate metabolism
    BBMN68_1612 (putA2)
   00650 Butanoate metabolism
    BBMN68_1612 (putA2)
  Lipid metabolism
   00071 Fatty acid degradation
    BBMN68_1612 (putA2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBMN68_1612 (putA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBMN68_1612 (putA2)
   00626 Naphthalene degradation
    BBMN68_1612 (putA2)
Enzymes [BR:blb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBMN68_1612 (putA2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BBMN68_1612 (putA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015463..2018192
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVARAKKALVEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMKHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDT
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSAVPGKSPQFIAKAAGFEIPSDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTNA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgactccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgtcgaattc
gagaacctcgaccagaagcaagttgatcgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggctaccaagaacatcttcgcctgtgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgtgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggtgtcaccccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacacgctgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagattgtgcgcgacgccgccatcgaagccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccacaggcgccctgatgaag
catccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctacgttgacacc
gatgttgacatcgtgcgcgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcactgccggttccggcgtcaagcccgtgctgaactccgcggtg
ccaggcaagtccccgcagttcatcgccaaggctgctggcttcgagattccgtccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagcctctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tccctcggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgtcgacaagatcatcgaccagctgcgc
gcccgctctaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagattatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctggtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggatccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaatggcgagcccggcctggccaagaccaacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgttacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgtgacaacaagctcggcatgaacaagagcttccaggattgcggtgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgtaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggtgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgttga

DBGET integrated database retrieval system