KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1687Help
Entry
BBMN68_1687       CDS       T01345                                 

Gene name
gpmA
Definition
gpma
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:blb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blb00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:blb00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blb00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095673..2096413
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaactagtactgctccgtcatggacagagcgcatggaataaaactaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacatcgtgttcacctccctgctgcgt
cgcgccatcaacaccgccaacatcgctctggatgccgcagatcgtctgtggattccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgacgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctacgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggcaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctctacgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgccgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system