KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1698Help
Entry
BBMN68_1698       CDS       T01345                                 

Gene name
folA
Definition
fola
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:blb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2106475..2107137
Genome map
AA seq 220 aa AA seqDB search
MEHDSSRSGYHEPEPGSAGLSATEEDWGDDYPKTFSVNLIWGEARDKEGRAGAIGLNGGM
PWHCAEDMKHFKELTVSHPVIMGRKTWESLGGKYRPLPNRDNIVVSHDPMYRAPGATVVT
SLDDALDMARQEAIPDDGLDRSEIWIIGGAQLFAKALPFADKAYVTDLAATVDADSYAPD
MASLVEAGMWREAEVGEWHTPAKEESGIDSYRFRILAKTK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgacagtagccgtagcggctatcacgaacccgagcccggatctgccgggctg
tctgccactgaagaagactggggtgacgattatcccaagaccttctcggtgaatcttatc
tggggcgaagcccgtgacaaggaaggtcgcgccggtgccatcggcctcaatggtggcatg
ccttggcactgtgccgaggatatgaagcatttcaaggagctgaccgtctcccatccggtg
attatgggtcgtaagacctgggaatcgctggggggcaagtaccggccgctgcccaaccgc
gacaacatcgtcgtttcccacgatccgatgtaccgtgcgccgggggccactgtggtcacc
agtcttgacgacgcgctcgatatggcccgtcaggaggcgattccggacgacggtctggac
cgttcggagatttggatcatcggcggcgcccagttgttcgccaaggctttgccgttcgcg
gacaaagcctatgtgactgatctggccgccaccgtggatgccgacagctacgcgcccgat
atggcgtcgctggtcgaggccgggatgtggcgggaagccgaagtgggcgagtggcatacg
cccgccaaggaggagtccggcatcgattcctatcgtttccgtatcttggccaaaaccaag
taa

DBGET integrated database retrieval system