KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1717Help
Entry
BBMN68_1717       CDS       T01345                                 

Gene name
folE
Definition
fole
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBMN68_1717 (folE)
Enzymes [BR:blb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BBMN68_1717 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2128639..2129238
Genome map
AA seq 199 aa AA seqDB search
MNENIESCQQEKRTYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQA
SPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARL
VEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVR
GLLRNPATRAEAMSLILDK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatatagagtcttgccagcaggagaaacgcacatacgacgaggaaggcgtg
cgcgaagccgtacgtctgttcctgaagtcgattggcgaggatcccgagcgcgagggactg
gtggaaacgcctgaccgtatcgcccgcgcgtgccgcgagctgttcgccggtctgcaggcc
tcgccggccgatgtgctggagaagcacttcgacgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtgtgcgagcatcacctgctgcctttccatggcgtggcc
catgtgggctacattcccgccaaggatggggtgatggggctgagcaagctcgcccgactg
gttgaggtgtatgctcgccggccgcaggtgcaggagcgtttgacccagcagatcgccgac
gcgctggtcgagtatgcgggcgcacgtggtgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgcggcatcaagaagtcttccgcccgcacggtgacctctgcggtgcgc
ggtctgctacgcaaccccgccacccgagccgaagccatgagtctgattcttgacaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system