KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1717Help
Entry
BBMN68_1717       CDS       T01345                                 

Gene name
folE
Definition
fole
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2128639..2129238
Genome map
AA seq 199 aa AA seqDB search
MNENIESCQQEKRTYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQA
SPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARL
VEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVR
GLLRNPATRAEAMSLILDK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatatagagtcttgccagcaggagaaacgcacatacgacgaggaaggcgtg
cgcgaagccgtacgtctgttcctgaagtcgattggcgaggatcccgagcgcgagggactg
gtggaaacgcctgaccgtatcgcccgcgcgtgccgcgagctgttcgccggtctgcaggcc
tcgccggccgatgtgctggagaagcacttcgacgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtgtgcgagcatcacctgctgcctttccatggcgtggcc
catgtgggctacattcccgccaaggatggggtgatggggctgagcaagctcgcccgactg
gttgaggtgtatgctcgccggccgcaggtgcaggagcgtttgacccagcagatcgccgac
gcgctggtcgagtatgcgggcgcacgtggtgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgcggcatcaagaagtcttccgcccgcacggtgacctctgcggtgcgc
ggtctgctacgcaaccccgccacccgagccgaagccatgagtctgattcttgacaagtga

DBGET integrated database retrieval system