KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1718Help
Entry
BBMN68_1718       CDS       T01345                                 

Gene name
folP
Definition
folp
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBMN68_1718 (folP)
Enzymes [BR:blb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BBMN68_1718 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129326..2130201
Genome map
AA seq 291 aa AA seqDB search
MTDLQALHDATHTMVMGVLNITEDSVSDGGLWLDPAKAAQHGRDMMAAGADIIDIGAEST
RPGAKRVSEADELARITGAVKTLIPAGAVLSIDTTRASVAAAALSEGAQIINDVSGGTLD
AELPHVVADHDCLYVVQHWRGWLVGSKGANPDQDTSVYEHGVLTDVHDELMRQVDGVLAA
GVKPERIIIDPGLGFSKPGIEHNLPLLTGLETFRATGYPVLIGQSRKRFISAMLTGAGTA
GADGLTMAQRDDVTAALSALSAEHGAWAVRVHDVAKSRAAVIAGNTWREYA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttgcaggcgttgcatgacgccacgcacaccatggtgatgggtgtgctcaac
atcaccgaggactcggtctcggacggcggcctgtggctggacccggccaaggcggcccag
cacgggcgcgacatgatggccgccggcgcggatatcatcgacatcggcgccgaatccacg
cgccccggtgccaagcgcgtgtccgaggccgacgaactggcccgtatcaccggtgccgtc
aagacgttgattccggccggtgccgtactgtccatcgacaccacgcgcgcatccgtggcc
gccgccgcgctgagcgagggcgcacagatcatcaacgatgtttccggcggcacgctggac
gccgagctgccgcatgtggtcgccgaccacgactgcctgtacgtcgtgcagcattggcgc
ggctggctcgtcggctccaagggcgcgaaccccgatcaagacacctccgtatacgagcat
ggcgtattgaccgacgtgcacgacgaactcatgcgccaagtcgacggcgtgctggccgcc
ggcgtaaagcctgagcgcattatcatcgatcctggtctgggcttctccaagcccggcatc
gagcataacctaccgctgctgaccgggctcgagaccttccgcgccactggatatccggtg
ctgattggccagtcccgcaagcgcttcatttcggcgatgcttaccggggcgggtactgcc
ggtgctgatggcctgaccatggcccagcgcgatgacgtgaccgcagccttgtccgccctg
tccgccgagcacggcgcatgggccgtgcgcgtacacgatgtggccaaaagccgcgccgcc
gtcatcgccggcaacacctggcgcgaatacgcatga

DBGET integrated database retrieval system