KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1718Help
Entry
BBMN68_1718       CDS       T01345                                 

Gene name
folP
Definition
folp
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129326..2130201
Genome map
AA seq 291 aa AA seqDB search
MTDLQALHDATHTMVMGVLNITEDSVSDGGLWLDPAKAAQHGRDMMAAGADIIDIGAEST
RPGAKRVSEADELARITGAVKTLIPAGAVLSIDTTRASVAAAALSEGAQIINDVSGGTLD
AELPHVVADHDCLYVVQHWRGWLVGSKGANPDQDTSVYEHGVLTDVHDELMRQVDGVLAA
GVKPERIIIDPGLGFSKPGIEHNLPLLTGLETFRATGYPVLIGQSRKRFISAMLTGAGTA
GADGLTMAQRDDVTAALSALSAEHGAWAVRVHDVAKSRAAVIAGNTWREYA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttgcaggcgttgcatgacgccacgcacaccatggtgatgggtgtgctcaac
atcaccgaggactcggtctcggacggcggcctgtggctggacccggccaaggcggcccag
cacgggcgcgacatgatggccgccggcgcggatatcatcgacatcggcgccgaatccacg
cgccccggtgccaagcgcgtgtccgaggccgacgaactggcccgtatcaccggtgccgtc
aagacgttgattccggccggtgccgtactgtccatcgacaccacgcgcgcatccgtggcc
gccgccgcgctgagcgagggcgcacagatcatcaacgatgtttccggcggcacgctggac
gccgagctgccgcatgtggtcgccgaccacgactgcctgtacgtcgtgcagcattggcgc
ggctggctcgtcggctccaagggcgcgaaccccgatcaagacacctccgtatacgagcat
ggcgtattgaccgacgtgcacgacgaactcatgcgccaagtcgacggcgtgctggccgcc
ggcgtaaagcctgagcgcattatcatcgatcctggtctgggcttctccaagcccggcatc
gagcataacctaccgctgctgaccgggctcgagaccttccgcgccactggatatccggtg
ctgattggccagtcccgcaagcgcttcatttcggcgatgcttaccggggcgggtactgcc
ggtgctgatggcctgaccatggcccagcgcgatgacgtgaccgcagccttgtccgccctg
tccgccgagcacggcgcatgggccgtgcgcgtacacgatgtggccaaaagccgcgccgcc
gtcatcgccggcaacacctggcgcgaatacgcatga

DBGET integrated database retrieval system