KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1719Help
Entry
BBMN68_1719       CDS       T01345                                 

Gene name
folB
Definition
folb
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2130312..2131724
Genome map
AA seq 470 aa AA seqDB search
MDTITLTGVHANGTHGVLTFEHERPQTFVVDVTLHLDLAAAGQSDDLNDTIDYGRVAKDI
VAVIEGPHVDLIERLAQRIADKILADAPAVASIDVTVHKPHAPIVVAFADVSVSISRVRA
TDNGRTAEKHAIHNAVVALGGNVGEVESTLRAAVREIDALLGTQVTGISPLYRTAAWGMA
DGTPDFLNAVVELGTTMGSHELLAALQNIEANHGRIRENHWDSRPLDLDIIDFDGITSAD
PDLALPHPRAWQRAFVLAPWAALNPNAKLAGAHEGPVADLLAAAPDRNAVQLESEDWMLG
GHAVKQESASESEPVSRKAIISLDSTSQDAERLFRETIVSIDSVPGNQVQGISPLYHVSH
FDSPDAMSAVIQIETKLPPADLIAVLGSIESVHDLAVDLDLVDMEGVTSDEPNCSIPWPS
ARNHASVLAPWLDMDPNASLGGDPVAFLLAMAPDAGQVGLLSDNWILSNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcacacttaccggcgtacatgccaacggcacccacggtgtgctcaccttt
gaacacgaacggccacaaaccttcgtcgtggacgtcaccctgcaccttgatctggccgcc
gccggccaatccgacgatctcaatgacaccatcgattacggccgcgtggccaaggatatc
gtggctgtcatcgaaggccctcatgtggacctgatcgagcgtctggcccaacgtatcgcg
gataagattcttgccgatgcgccggccgtcgcctccatcgacgtcaccgtgcacaagcct
cacgcgcccatcgtcgtggcttttgcagatgtatcggtctccatctcgcgcgtgcgtgcc
accgataatggacgcactgctgaaaagcatgccatccataacgcggtggtggccttgggg
ggcaatgtgggcgaggtggaatccaccttgcgagccgccgttcgggagattgacgcgctg
cttggcacacaggtgaccggtatttcgccgctttaccgcacggccgcgtggggcatggct
gacggtacgccggatttcctgaacgccgtggtggagcttggaaccacaatgggcagccac
gaattgctcgccgcgttgcaaaacatcgaagcgaaccatgggcgaattcgtgagaatcat
tgggattccaggccgttggacttggacattatcgactttgatggcatcaccagcgcggat
ccggatctggcattgccccatccgcgtgcttggcagcgcgcatttgtgctggctccctgg
gcggcgctgaatccgaacgccaaacttgctggagcccatgaggggcctgtagccgatttg
ctggccgccgcgccggaccgtaacgccgtgcagctcgagagcgaagactggatgctcggc
gggcatgcagtcaagcaagaatcagcgtcggagtcggaacccgtctcacgcaaggcgatt
atttcgctggattccacctcgcaggatgccgaacggctgttccgcgaaaccatcgtttcc
atcgacagtgttcctggcaatcaggtacagggcatctcgccgctctaccatgtcagccat
ttcgacagtccggacgcgatgagcgcggtcatccaaatcgaaaccaagttgccgcccgcc
gacctgattgccgtattgggcagcatcgaaagcgttcatgacctggcagtcgaccttgac
cttgttgacatggaaggcgtgacttccgacgagcccaactgcagcattccttggccgtcg
gcccgtaaccatgcgtcggtattggcaccttggctggatatggacccgaatgcttctctg
ggcggcgacccggtggccttccttttggccatggcaccggatgccggacaggtcggattg
ctatcggacaactggatactgtcgaatagttga

DBGET integrated database retrieval system