KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1723Help
Entry
BBMN68_1723       CDS       T01345                                 

Definition
nagc-type transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBMN68_1723
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_1723
   00052 Galactose metabolism
    BBMN68_1723
   00500 Starch and sucrose metabolism
    BBMN68_1723
   00520 Amino sugar and nucleotide sugar metabolism
    BBMN68_1723
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBMN68_1723
   00524 Butirosin and neomycin biosynthesis
    BBMN68_1723
Enzymes [BR:blb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBMN68_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2136164..2137114
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLMELCGGDISKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaactaagatcgccgccgccgtctgcgatgaa
aacgatagcatcatccagcgctggcgcgtccccacgccgatggatgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccggacacaccgatatcgaggcc
atcggcatctccgccgccggcaacgtgagcgccgaccgcaagacgctcaccttctccgcc
aacatcccggcctggatcaactacgacctgtccgagcacgtcggcgcgctgatcgaccat
gccgtgccggtcgttgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgccggccagggcagctccaacatggtcgccctgaccgtgggcaccggcctcggcggc
gccatcgtgatcaacggtcagctgtaccgcggctccttcggcatggccgccgaactcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgag
cgctacacctcgggcacttcgctggagaacttcgccaagtccgccgtgcgccgtcgtccg
caggatgccaagcgtctcatggagctgtgtggcggcgacatctccaagctggaaggcccg
atggtctcccaggccgcccaggaaggcgacgtgctcggcctgtacgcattcggcaagatc
ggcgaatggcttggccgcacgatggccgcagtctccgccgtgctcgatccggacctgttt
gtgatcggcggcggtgtggtggccgtcggcgacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgccgccacc
gccggccaagacgccggcctcatcggtgccgccaacctggctctgcgctga

DBGET integrated database retrieval system