KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1736Help
Entry
BBMN68_1736       CDS       T01345                                 

Gene name
xylA
Definition
xyla
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:blb00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:blb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2149308..2150657
Genome map
AA seq 449 aa AA seqDB search
MGLWDVDKIEYVGRAKGPKEDFAFHYYDADKVVAGKKMKDWLRFGVAWWHTFNQELVDPF
GTGTAHRPYYKYTDPMDQALAKVDYAFELFQKLGVEYFCFHDRDIAPEGDTLRETNANLD
KVVDKIDENMKSTGVKLLWNTSSLFTNPRFVSGAATSPFADIYAYAGGQLKKSLEIGKRL
GAENYVFWGGREGYENLWNTEMKRETDHIAKFFHMCADYAKEIGFEAQFLIEPKPKEPTL
HQYDFDAATAIEFLRNHDLTDVFKLNLEGNHANLAGHTYQHEIRVARESGFLGSLDANQG
DKLIGWDMDEFPTDLYETVAVMWEVLQAGSIGPHGGLNFDAKPRRTSFYEEDLFRSHIAG
MDAYAAGLLVADKMNQDGFIQNLQAERYSSYDSGIGKDIDEGNVTLADLEAYSLDKPQSE
LIAATKSDHLESVKATINNYIIDALAEVE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtgggatgttgacaagatcgagtacgtcggccgcgccaaaggaccgaaggaa
gacttcgccttccattactacgatgccgacaaggtcgttgccggcaagaagatgaaggat
tggctgcgcttcggcgttgcttggtggcacaccttcaaccaggaactggttgatccgttc
ggcaccggcaccgcgcaccgcccgtactacaagtacaccgatccgatggaccaggctctg
gccaaggtcgactacgccttcgagctgttccagaagctgggcgtcgagtacttctgcttc
cacgatcgtgacatcgcccccgaaggcgacaccctgcgcgagaccaacgccaacctcgac
aaggtcgttgacaagatcgacgagaatatgaagtccaccggtgtcaagctgctgtggaac
acctcctccctgttcaccaacccgcgcttcgtgtccggcgccgccacttctccgttcgcc
gacatctacgcctacgccggtggccagctcaagaagagcttggagatcggcaagcgcctg
ggcgctgagaactacgtgttctggggtggccgcgaaggctacgagaacctgtggaacacc
gagatgaagcgcgagaccgaccacatcgccaagttcttccacatgtgcgcagattacgcc
aaggaaatcggctttgaggcccagttcctgatcgagccgaagccgaaggagccgacgctg
caccagtacgacttcgatgccgccaccgccatcgagttcctgcgcaaccacgacctgacc
gacgtcttcaagctgaacttggaaggcaaccacgccaacctggccggccacacctaccag
cacgagatccgcgtggcccgcgagtccggcttcctcggttccctcgacgccaaccagggc
gacaagctcatcggctgggatatggacgagttcccgaccgatctgtacgagaccgtcgcc
gtcatgtgggaagtcctgcaggccggctccatcggacctcacggtggtctgaacttcgac
gccaagccgcgccgtacctccttctacgaggaggacctgttccgctcccacatcgccggc
atggatgcctacgccgccggcctgctggttgccgacaagatgaaccaggacggcttcatc
cagaatcttcaggccgagcgctacagctcctacgactccggcatcggcaaggacatcgac
gagggcaacgtcaccttggccgacctcgaagcctacagcctcgacaagccgcagtccgag
ctcatcgccgccaccaagtccgatcacctcgagtccgtcaaggccaccatcaacaactac
atcattgatgccctggctgaggtcgagtga

DBGET integrated database retrieval system