KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_179Help
Entry
BBMN68_179        CDS       T01345                                 

Gene name
acyP
Definition
acyp
Orthology
K01512  
acylphosphatase [EC:3.6.1.7]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Pyruvate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBMN68_179 (acyP)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBMN68_179 (acyP)
Enzymes [BR:blb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     BBMN68_179 (acyP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211098..211391
Genome map
AA seq 97 aa AA seqDB search
MRQSANLVRKHIVVNGLVQGVGFRYFTVTQARRLGVRGWVRNCRDGSVELEAQGSSDAVQ
ALVEQLAIGPRWSEVSHVAVHDMPIIDETARAFGVRQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaatcggcgaatttggtccgcaaacatatagtggtcaacggactggtgcaaggc
gtgggattccgttattttacggtgactcaggcacgtcggcttggtgtacggggttgggtg
cgtaattgtcgcgatggctcggttgagctggaagcacaaggcagcagcgacgcagtgcaa
gccttggttgagcaattagccattggcccgcgatggtccgaagtgagtcacgtcgccgtg
catgacatgccgattatcgatgagaccgctcgggcatttggcgtgcgtcaataa

DBGET integrated database retrieval system