KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1791Help
Entry
BBMN68_1791       CDS       T01345                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BBMN68_1791
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBMN68_1791
Enzymes [BR:blb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BBMN68_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2220843..2221163
Genome map
AA seq 106 aa AA seqDB search
MVGWPGSRQNSLFTITADTHEVRHNPEYYVMRHFSKYVRPGAKVLGTTSHFNSMAIAFRN
PDGTIVVVTQNALEDERPFEFADPADASRGFKATLAPRSFNTFVIE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggctggccggggtcgcgccagaactccctgttcaccatcaccgccgacacgcac
gaggtgcgccacaaccccgaatactacgtgatgcgccacttctccaagtacgtgcgcccc
ggcgcgaaggtgctcggcaccaccagccacttcaactccatggccatcgccttccgcaac
ccggacggcaccatcgtggtcgtgacccagaacgcgctggaggacgaacgcccgttcgag
ttcgccgacccggccgacgcctcccgtggcttcaaggccacgctcgccccgcgctccttc
aacaccttcgtcatcgagtga

DBGET integrated database retrieval system