KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1791Help
Entry
BBMN68_1791       CDS       T01345                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blb00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:blb00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2220843..2221163
Genome map
AA seq 106 aa AA seqDB search
MVGWPGSRQNSLFTITADTHEVRHNPEYYVMRHFSKYVRPGAKVLGTTSHFNSMAIAFRN
PDGTIVVVTQNALEDERPFEFADPADASRGFKATLAPRSFNTFVIE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggctggccggggtcgcgccagaactccctgttcaccatcaccgccgacacgcac
gaggtgcgccacaaccccgaatactacgtgatgcgccacttctccaagtacgtgcgcccc
ggcgcgaaggtgctcggcaccaccagccacttcaactccatggccatcgccttccgcaac
ccggacggcaccatcgtggtcgtgacccagaacgcgctggaggacgaacgcccgttcgag
ttcgccgacccggccgacgcctcccgtggcttcaaggccacgctcgccccgcgctccttc
aacaccttcgtcatcgagtga

DBGET integrated database retrieval system