KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1799Help
Entry
BBMN68_1799       CDS       T01345                                 

Definition
(GenBank) Hypothetical protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BBMN68_1799
Enzymes [BR:blb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BBMN68_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB LacI Peripla_BP_3 Phos_pyr_kin HTH_3 HTH_38 Peripla_BP_1 Peripla_BP_4 HTH_Tnp_ISL3 HTH_23 HTH_19 HTH_26
Motif
Other DBs
NCBI-ProteinID: ADQ02856
Position
complement(2231248..2233128)
Genome map
AA seq 626 aa AA seqDB search
MNIRDIARIAGVSTSTVSKIVNGKDSSISEETRKKVLTIVKEYHYKPYASASQRTRSYTI
GVLLRSPISFDSTLDGIIQAAQNAGYATDAYNSYSDPERELKNIAAICGRNVDGVIWEPA
TPDSLAYASQFPESTPLLTIGPNGGDQSLLLPYKEAAYKLTSELIERGHQHIACLMTKGR
RTQDFLEGFRSCLFDHQLPYSDDLVYYDLNDSLPGKIGSRDITGFVSSHYRRALEFTQMI
SPLHYRLPEDASLVSIKNDTAEALAYPGNTEISTYTIRNSDFGAYLCEKLIAQIEHDKEQ
HPSFVQDFHLDNTSTIAAPPTSAIKHVLVVGSINIDHYLSVPRLPHIGGTVSTKSAARYP
GGKGVNQAIGAAKLGHRVTLIGNVGVDNGSDYIFKAMEQHGVNTAGVRRCAGEDTGSSFI
FLAPNGESVIAILSGANASLTPDDITSNERLFDNAGYCLIQTEIPLESAKVTAITARRHH
AKTIIKPSSCDYLPDSIVANADILVPNEHELAIIETEGKTMEDKAAHLLERGAGCVIVTQ
GEHGCYLRGQNVECHYPAADFTPVDSTGAGDAFISALASYLMYGYTVRQAVEIATYAAGY
SITRKGVIPSLIDRLSLDAYVHHSEQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcagggacatcgcacgcatcgcgggcgtctccacctcgacggtctccaaaatc
gtcaacggcaaggattccagcatcagcgaggaaacccgcaagaaggtcctgacgatcgtc
aaggaatatcattacaagccatatgcctccgcctcacagcgcacgcgtagctacaccatc
ggagtgctgctgcgctcccccatctccttcgatagcacgctggacggcatcatccaggcc
gcccagaacgccggatacgcaaccgatgcctacaacagctattccgatccggaacgcgag
ctcaaaaacatcgcagcgatatgcggccgcaacgtcgacggcgtcatctgggaaccggcc
actccggacagcctcgcctatgcctcgcaattccccgaaagcaccccactgctgaccata
ggacccaacggcggcgaccagtcactgctactgccttataaagaagcggcctacaaactg
accagcgagctcatcgaacgggggcaccaacacatcgcctgcctaatgaccaagggacgc
cgcacgcaggattttctcgaaggctttcgctcctgcctgttcgatcatcagctgccttat
agcgacgatctggtctactacgacctcaacgactcgctgcccggcaaaatcggaagccgg
gacatcaccggatttgtctcctcgcattaccggcgagcactcgagttcacgcagatgatc
agccccctgcattaccggcttccagaggatgcttcacttgtctccatcaaaaacgacacc
gccgaagcgctggcctatcccggcaacacggaaatatctacctacaccatccgcaactcc
gacttcggcgcctacctctgcgagaagctcattgcgcagatagagcacgacaaagagcag
catccctcgttcgtacaggattttcatctcgacaacaccagcaccatcgcagccccgccc
acttccgccatcaaacatgtgttggtcgtcggcagcatcaatattgaccactatctgtca
gtgccgcggctacctcatatcgggggtacggtatccaccaaatcggcggcgcgatacccc
gggggcaaaggggtcaatcaggcgatcggcgcagccaagctcgggcaccgcgttaccctt
atcggcaatgtcggcgtcgataatgggtccgattacatcttcaaggcgatggaacagcat
ggggtcaatacggccggtgtgcgacgctgcgccggagaggacaccggctcatcgttcata
ttcctcgcccccaacggcgaatcggtcatcgcgattctctccggagccaacgcgtcgctc
accccggatgacatcacctccaacgaacgcctgttcgacaatgccggatactgcctgata
cagaccgaaataccgttggaatcagccaaagtcaccgcgatcaccgcccgacgacaccat
gccaaaaccattatcaagccctcgtcatgcgactatctgcccgactccatcgtcgccaat
gccgacattctcgtgccgaacgagcacgaactggcgatcatcgaaactgagggaaaaaca
atggaggataaggccgcgcatcttctcgaacgcggcgcgggctgcgtcatcgtcacccaa
ggagaacacggctgctacctgcgcggccagaatgtcgagtgccactatccggccgctgac
ttcacccccgtagacagcaccggagccggcgacgcgttcatcagcgcgctcgcctcgtat
ctgatgtacggatacaccgtgcggcaggcggtcgaaatcgccacctatgccgccgggtac
tcaatcacccgcaaaggcgtcataccctcgcttatcgaccggctctcgctggacgcctac
gtccatcacagcgaacagtag

DBGET integrated database retrieval system