KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_246Help
Entry
BBMN68_246        CDS       T01345                                 

Gene name
murE1
Definition
mure1
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BBMN68_246 (murE1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBMN68_246 (murE1)
Enzymes [BR:blb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BBMN68_246 (murE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(300670..302223)
Genome map
AA seq 517 aa AA seqDB search
MALTLASAADLLKEHHLLREIIQGDVWTDDPARIASADEPFAGITYDTRKVTPGTLLCCK
GRFKAEYLNGIDEAGLAAYVAETEYSAATATPGLIVNDARKAMSLLSAAFYGYPQNELTV
IGVTGTKGKTTTSYFTQALINAVSGGKAALFSSVDNCLDGHTYVESDLTTPESMDAFRMM
REAADNGMKYLVMEVSSQAYKVDRVYGLTFDVAAFLNISPDHISPIEHPTFEDYLYCKRQ
IIANAKSLVLGADSLHADLLREDAEAAGIGVTTFALHDADNAGTSADVVAWPADPEHASF
HIADGDQALGDYHLSIDGDFNYLNAAAAIAIAHAAGVSLDDAGALHAIESVRIAGRMEQF
RDPQSNTLAIVDYAHNYASVTALLDFVYERWGEENPRITLVTGSAGNKAYDRRKEIVEAA
ENRIANFIFTAEDTDTEPFIDICMEMQGYITNKDVASTVISDRPTAITNAIYDARAHADR
FNILLIIGKGNERWIKDHHKHVPFDGDDHVVERMFGL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctttgactttggcttcggccgctgacctgctcaaggaacaccatctgctgcgtgaa
atcatccaaggggatgtctggaccgacgacccggcccgtatcgcttcggcggatgaaccg
ttcgccggcatcacctacgacacccgcaaggtcacgccgggcaccctgctgtgctgcaag
ggccgattcaaggccgagtatctgaacggcatcgacgaagccggcctggccgcatacgtg
gccgaaaccgagtactcagccgcaaccgccacccccggcctgatcgtcaacgacgcacgc
aaggcgatgagcctgctgtccgccgcgttctacggatatccgcagaacgagctcacggtc
atcggcgtcaccggcaccaagggcaagacgaccacctcgtacttcacgcaggcgcttatc
aacgccgtctccggtggcaaggccgcattgttctcctcggtcgataattgccttgacggc
cacacctacgtcgaatccgatctgaccacgcccgaatcgatggacgccttccgcatgatg
cgcgaggcggccgataacggcatgaagtatctggtgatggaggtctcctcccaggcgtac
aaggtggaccgcgtctacggactgactttcgatgtggccgcgttcctgaacatctccccc
gaccacatcagcccgatcgaacaccccacgttcgaggattacctgtattgcaagcgccag
atcatcgccaacgcgaagtcgctggtactcggcgcggacagtctgcacgccgatctgttg
cgggaggacgcggaggcagccggcatcggcgtgaccaccttcgccctgcatgacgcggat
aatgccggcaccagtgcggacgtcgtcgcctggcccgccgacccggagcacgcctccttc
cacatcgccgacggagatcaggcccttggcgactaccatctgtccatcgatggcgacttc
aactacctcaatgcggcggcggccatcgccatcgcccatgcggctggcgtatcgctcgat
gacgccggcgcactgcacgccatcgaatccgtacgtatcgccggccgtatggaacagttc
cgcgatccgcagtcgaacacgctcgccatcgttgattatgcgcacaactacgcatccgtc
accgcgctgcttgacttcgtctacgagcgttggggcgaggaaaacccgcgtatcacgctg
gtgaccggatcggccggcaacaaggcctacgatcgtcgtaaggaaatcgtcgaggctgcc
gagaaccgtatcgcgaacttcattttcaccgccgaagatacggacaccgagccgttcatc
gacatctgcatggaaatgcaaggctacatcacgaacaaggatgtggcctccacggtgatt
tccgaccgtccgacggccatcaccaacgccatttacgatgcccgtgcgcacgccgaccga
ttcaacatcctgctgatcatcggcaagggcaacgagcgttggatcaaggaccatcacaag
catgtgccgttcgacggcgacgatcacgtggtcgaacgcatgtttggcttgtga

DBGET integrated database retrieval system