KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_281Help
Entry
BBMN68_281        CDS       T01345                                 

Gene name
xthA
Definition
xtha
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:blb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BBMN68_281 (xthA)
Enzymes [BR:blb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     BBMN68_281 (xthA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339621..340481
Genome map
AA seq 286 aa AA seqDB search
MTITITTSNVNGIRAAKRKGIEDWAGKHAPDVWCMQEVRAPQEDVDSIFGEFGFEYATAG
KIASPSDLHSLNEVCRVKGRAGVGLLTDLEVTDKRYGLPSLGEDVDSGRWIETDVKTPQG
YTITVACVYVHAGNTDDSTKMEQKYRFLDTMLTRMGELRDEAAHGGKQAVLCGDFNIAHT
PLDIKNAKANEKHAGFLPEERAYVDKWLDEYEFVDVMRSLAGDIQGPYTWWSQRGRAFDN
NVGWRIDYQFATPELAETARGFVIDKAPTYELRWSDHAPLTITYDV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccatcaccacatcgaacgtcaacggcattcgcgcggcaaagcgcaagggc
atcgaggactgggccggcaaacatgctccggatgtctggtgtatgcaggaagtgcgcgcc
ccgcaagaggatgtcgattcgattttcggcgaattcggtttcgagtatgccaccgccggc
aagatcgcctcaccctctgacctgcattcgctgaacgaggtctgccgtgtcaagggtcgt
gccggagtcgggctcctcaccgatcttgaggtgaccgataagcgctatggacttccgagc
ttgggcgaggatgtggattccggccgttggattgagaccgatgtcaagacgccacaggga
tacacgatcaccgtggcctgcgtgtacgtgcacgccggcaacaccgatgattcgaccaag
atggaacagaagtaccgttttctggacacgatgctcactcgcatgggcgagttgcgcgac
gaggccgcgcacggcggcaagcaggcggtattgtgcggcgatttcaacatcgcgcacacg
ccgctcgacatcaagaacgccaaggccaacgaaaagcacgccggcttcctgcccgaggag
cgcgcctacgtggacaagtggctggatgaatatgagtttgtggatgtgatgcgttcgctc
gccggtgatattcagggtccgtacacgtggtggagccagcgcgggcgcgctttcgacaac
aatgtcggctggcgcatcgactaccagttcgccacgcccgagctggcggagaccgcgcgc
ggttttgtgatcgacaaggcccccacatacgagttgcgttggtccgaccacgcgccactt
accatcacatacgacgtgtga

DBGET integrated database retrieval system