KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_322Help
Entry
BBMN68_322        CDS       T01345                                 

Gene name
rbsK1
Definition
rbsk1
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BBMN68_322 (rbsK1)
Enzymes [BR:blb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BBMN68_322 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389897..390859
Genome map
AA seq 320 aa AA seqDB search
MPEPVRERLEALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKVLPGGKGANQA
SAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGTTVITVSAEGENT
IVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDAGVTVLLNDSP
FMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYGFDRAIATLGA
SGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQIGSYVSAYAA
TKLGAQSAYGTAEEVIAYFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtacgggaacgattggaagcgctgaaggatgcgccgggctcggtaatc
gtggtcggctcgatgaacgccgattacaccgtaaccactaaacgactacccaagccaggt
gaaaccgtcaatggtggtgccatgaaagtgctgccgggcggcaagggcgcgaatcaggcg
tctgccgccgctcgtctcggtgtcaatgtccagttgctgggcgcggtgggcgaggactcc
aacgcggacttcctattaagcaagctggatgaggccggcgtcgacaccgccgatatcctg
catgtcgaaggccccagcggcaccacggtaatcaccgtgagcgctgagggcgagaacacc
atcgtctattcgccgggttccaatgccaaggcaagtgccggctatgtgcaatcacatcgc
acgaccatcgccgaatgcgcggtattgggactgtgtttggagagcccgattgccaccgtt
atcgccgccgcgcagaccgcgcatgacgctggcgtgaccgtgctgctcaacgactcgcca
tttatggacgagctgcctcacgaactggtggaagccacggatattctgctggtcaaccag
catgaagtggctcaactgctgggcctgccggatgatgacgtggaatcactcgactggtac
gaggtcgccgaacgattcaccgattacggattcgaccgggcgatagcgacgcttggtgcg
tcgggatcggtggtgatcgagaacggacgttggcatcgcgtatccgccgcgcaagtcaat
gcagtggacaccaccggttgcggcgactcgttcatggggaccgtgctggctggcttggcc
gccggtcatacgctgctgcaatccgcgcaaatcggctcctacgtctccgcctatgcggcc
accaagctcggtgcccaaagtgcctacggtaccgccgaagaagtcatcgcctacttcagc
tga

DBGET integrated database retrieval system