KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_352Help
Entry
BBMN68_352        CDS       T01345                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00010  Glycolysis / Gluconeogenesis
blb00260  Glycine, serine and threonine metabolism
blb00680  Methane metabolism
blb01100  Metabolic pathways
blb01110  Biosynthesis of secondary metabolites
blb01120  Microbial metabolism in diverse environments
blb01130  Biosynthesis of antibiotics
blb01200  Carbon metabolism
blb01230  Biosynthesis of amino acids
Module
blb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_352
  Energy metabolism
   00680 Methane metabolism
    BBMN68_352
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_352
Enzymes [BR:blb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBMN68_352
Membrane trafficking [BR:blb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBMN68_352
Exosome [BR:blb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBMN68_352
  Exosomal proteins of melanoma cells
   BBMN68_352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Glyco_hydro_108
Motif
Other DBs
NCBI-ProteinID: ADQ03059
Position
425634..426479
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVIDS
AYSDSTPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPTE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggtcgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgaacatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgccagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccagtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtgggccagcgaggtgccgatgccgtgcgcgcactggtcatcgactcc
gcctattcagacagcacgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctgctcgaactcgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgttggtgccggcttaaagtgcgccacagcgtcaacggcacccccaccgaa
cagccactgtgggagttggaggaatacaacaaggctcccgccattgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccaagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system