KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_400Help
Entry
BBMN68_400        CDS       T01345                                 

Gene name
tpiA
Definition
tpia
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBMN68_400 (tpiA)
   01230 Biosynthesis of amino acids
    BBMN68_400 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_400 (tpiA)
   00051 Fructose and mannose metabolism
    BBMN68_400 (tpiA)
   00562 Inositol phosphate metabolism
    BBMN68_400 (tpiA)
Enzymes [BR:blb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBMN68_400 (tpiA)
Exosome [BR:blb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBMN68_400 (tpiA)
  Exosomal proteins of bladder cancer cells
   BBMN68_400 (tpiA)
  Exosomal proteins of melanoma cells
   BBMN68_400 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484205..485008
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAKLIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVRILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSTKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttt
aaacgctgcgaagtcgcgcttttcccctcgttcacatcattgcgcagcgtgcaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgctcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgtgacgtcacc
cgcgatctcaacgaagaacaagccgccaaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacttttggcacgaaggtatccgatagcgtacgtatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccctggacgttgaggaactcgccaaaatcgctcgactggcactg
aaatccacgaaatcacggaactaa

DBGET integrated database retrieval system