KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_418Help
Entry
BBMN68_418        CDS       T01345                                 

Gene name
ruvA
Definition
ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:blb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505680..506306
Genome map
AA seq 208 aa AA seqDB search
MIGMLTGRVESVETDTALIDVGGVGYEVRMSATDLSRLHAGQDTRVFTYMNLSQDAITLH
GFLDRDAKKTFLQLIKVSGIGPKVAQSLLSTLTPSQLAHAIADNDATALAKAPGLGKKGA
QKIILELKGSIDLSQIEGASAQAAISKSPVDTGTEQVVEGLISLGWRQQDAQQAVAEACA
ENDIPTPLATDDVPRVLRLALALMDRGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgctgaccgggcgggttgaatcggtcgaaaccgataccgcattgattgat
gttgggggagtgggctacgaagtgcgcatgtccgccaccgacctgagccgtctgcacgcc
gggcaagacacccgcgtcttcacctatatgaacctctctcaggatgccattaccctgcat
ggattcctggatcgggacgccaagaaaacctttctgcaactcatcaaggtctccggcatt
ggacctaaagtggcccaatcgttactctccacactgacgccgagtcagctggcccacgcc
atcgccgacaacgacgccaccgcgctggccaaggctccggggctgggcaagaagggcgca
cagaaaatcatcctcgagcttaagggctctattgatttgagtcagatcgagggtgcttcc
gctcaggcggcaatatccaagtctccggtggataccggtacggaacaggttgtcgaagga
ctgatttcacttggctggcgtcagcaggacgcccaacaggccgttgccgaggcttgcgcc
gaaaacgatattcccacgccgcttgccaccgacgatgtgccgcgtgtgctacgtctggct
ttggcgctgatggataggggccgctga

DBGET integrated database retrieval system