KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_469Help
Entry
BBMN68_469        CDS       T01345                                 

Gene name
trpBC
Definition
trpbc
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBMN68_469 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_469 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBMN68_469 (trpBC)
Enzymes [BR:blb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBMN68_469 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(556984..559071)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELLAGALEDQRTRELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGRKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADNHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYTQAKADPKFHKEFMTLQQRYVGRPSPLTEAPRFSALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGAHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactgctggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggatgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccgcaaattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccagtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgacctagtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctcgatctggcgcacgagctcggc
atgactgtgctggtggagacgcacacccgcgaagagatcgaacgcgcccgcaaggccggt
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtagcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgacaatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctcatcaccgccctcgacgagcttgagcgc
gtgtacacgcaagccaaggccgaccccaaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgcccgagcccgctgaccgaagccccgcgcttctccgcacttgtcaaa
gagaagaccggtctcgacgcccgtatcttcctcaagcgtgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggccctgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacccttggcgacaag
atcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacttgctcggcaccgtcgcgggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaggccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggt
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgtgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaagcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggctacctgaccgacgaccag
gccgccgcgctcgatgtgaccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system