KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_534Help
Entry
BBMN68_534        CDS       T01345                                 

Gene name
pyrB
Definition
pyrb
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:blb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:blb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(607968..608930)
Genome map
AA seq 320 aa AA seqDB search
MVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEIAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPQYVIDRINATDSCSYVEVRDLASVIGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLVRMALES
TVVGDELPGYEPLNPKEVQA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcaaaagcgtcgtaacgctggacggcctgtctacaaaccagattctcgacctg
ctgcataaggccgaatacatcgattcccaccgcaaagagattgcccatacctgcgatggg
cgagtgctggccacgctgttctacgagccctccacccgtacgcgcctgagctttgagacc
gcaatgctacgtctcggcggcaaggtcatcggattcgccggcgcgcagctggcctccgtg
accaagggcgaatccatcgccgacacgttgaagaccgtgtccaactacgtggacgtggtc
gccatccgtcacccgaaggagggtgccgcgctggtggcctcccgcgccgcatccgtgccg
gtaatcaacgccggcgacggcggccacatgcaccccacgcagacgctggccgacctggcc
acgctgcagtcgcgcttcggccgcatcaccgacctgaccgtgggactgtgcggcgatttg
accttcggccgcaccgtgcactccctgatcgagaccctgtgccgcttcggcaacgtgcgc
ttcgtgctcatcagcccggacgagctcaagaccccgcagtacgtgatcgaccgcatcaac
gccaccgacagctgctcctacgtggaagtgcgcgacctggcctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtacagaaggaacgcttcttcaacgaagacgactacctg
cgcctgcgcgacacctacattctcgacgaagagaagctgcagctcgccaagccgtccatg
gccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtggacgtggacgacgacccg
cgtgccgcctacttcgaacaggtcaagaacggcatgctcgtgcgcatggccctcgaaagc
accgtggtgggcgacgaactgcccggatacgaaccgctcaaccccaaggaggttcaggcc
tga

DBGET integrated database retrieval system