KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_727Help
Entry
BBMN68_727        CDS       T01345                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBMN68_727
   01230 Biosynthesis of amino acids
    BBMN68_727
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_727
  Energy metabolism
   00680 Methane metabolism
    BBMN68_727
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_727
Enzymes [BR:blb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBMN68_727
Exosome [BR:blb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBMN68_727
  Exosomal proteins of melanoma cells
   BBMN68_727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829348..830046
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSVFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKRLYVDRRQEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDRRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccgttttccttatccgtcatggacgcacctcctacaacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaaggctgtacgtcgatcgtcggcaggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaagctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcgtcgcgtccgtgaacgcagcttcggtgat
tgggatggccatgccgtggccgaactggccgaacgctaccccgaggacttccgttcctgg
atggagtctcggggcggcgagctgaagtatggtgccgagcccaaggaagctgtgggcaag
cgcggcgtagaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggattgcgcagacattgcagaccctgttgggcatttctgca
atcgatccgaccttttctacggtggtttcattgcgtaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggaacgcgaacgctga

DBGET integrated database retrieval system