KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_777Help
Entry
BBMN68_777        CDS       T01345                                 

Gene name
bglX1
Definition
bglx1
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBMN68_777 (bglX1)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BBMN68_777 (bglX1)
Enzymes [BR:blb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBMN68_777 (bglX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
895592..896770
Genome map
AA seq 392 aa AA seqDB search
MVLAGVAAYGWHVGWFAKSTSNGNTTTPQTSQTSALPRADVPSPKKNEPAAQAQRAVSAM
TLEERVGQLVMVPLLAGSDPSSLASTIADEHIGSAILIGNWNTGADTVKTATAQLQGYAP
AGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQLAAAGINVD
LAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRDAQVGAAVKHYPGLGA
VSGNTDFTTEGILDTTTTLGGAEAGAFDQAITKTDPAMVMMSLATYQSIDPNNPAVFSST
IIDGHIRNALKYTGVVISDSMSAEALSSYDVSQLGVKLVEAGGDMSCIGQTDYVKPIVDG
LNERAKSDPAFASKVTAAATRVMALKIKMGLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttggccggcgtggcagcctacggatggcatgtcggatggttcgccaaatccaca
tcaaacggcaacaccaccactccccagacctcccagacaagtgcgttaccacgcgccgac
gttccttccccgaagaagaacgaaccggccgcacaagcccaacgtgcggtatccgccatg
acacttgaggaacgtgtgggacagttagtgatggtgccgttgcttgccggttccgatccc
tcctcgttggcttcaacaatcgccgatgagcacattggctcggccattctcattggcaat
tggaataccggcgccgatacggtcaagaccgcgaccgcgcaactccaaggatatgcgccg
gccggcaatcgtctcatcatcgccaccgatcaggagggtggtcaggtgcagcatctgact
ggtaccggtttcgacacaatgcccagtgccgttgagcagggcacaatgtccgctgacgca
ttgcgtcaatcggcaggcacgtggggttcgcaattagctgctgctggcataaatgtcgat
ttggcaccggtgctcggcacggtggtgggcgatcgtgcctcaaatgctccgattggcgcg
ctggatcgtgatttcggattggatgcggccggcaacgccgaacatggcatcgccgttatt
gaaggtttgcgagacgctcaggtcggcgcggcggtcaaacattatcctgggttgggcgcg
gtaagcggcaataccgacttcaccaccgaaggcattctggatacgaccaccacgttgggc
ggggccgaggcaggtgcctttgaccaggcgatcaccaagaccgatcctgcgatggtgatg
atgtcgttggccacgtatcaatccatcgacccgaataatccggcggtgttttcttctacg
attatcgacggtcatattcgcaacgccctgaagtacacgggcgtggtgatttcggattcg
atgtctgccgaagcgttaagcagctacgatgtaagccaattgggagtaaagcttgtcgag
gcgggcggcgacatgtcctgcatcggtcagacggattacgtaaagccaattgtggacggc
ctcaacgaacgggcgaagtccgatccggctttcgcttcgaaagtgacggcggcggcgact
cgcgtaatggcattgaaaatcaagatgggactggcctga

DBGET integrated database retrieval system