KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_782Help
Entry
BBMN68_782        CDS       T01345                                 

Gene name
thrC
Definition
thrc
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBMN68_782 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_782 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BBMN68_782 (thrC)
Enzymes [BR:blb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BBMN68_782 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
901176..902666
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNQWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDALARETGTTAPAALRGLETADVRFKDVV
AIDGMEDYVEKAAQSL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaccgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcaaatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgacgagcgcatcaccccgctcaagcccctgggcgacgattacgtg
ctcgaactgttcaacggcccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggagctgcagatg
accacgcaagccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgcgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcctacgcccaactgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagttcgtggtcccgaccggcaacttcggcgatatcctcgccggctactacgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgcctgatctccatgctgatgaacgacctcaaccagtggggcacgtacgag
atcccggaagaactgctggccaagattcgccagatcttcggcaccggctgggccgacgag
gaccaggtgcgcgaatccatcaagcactgctgggacgagaaccactacgtaatcgacccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggctctgggc
ttcgacgccaccggcaccgacttcgagtgcatggacgcgctggcccgtgagaccggtacc
actgccccggccgccctgcgtggcctcgaaaccgccgacgtgcgtttcaaggacgtcgtg
gccatcgacggcatggaggactacgtagaaaaggccgcccagtcactgtaa

DBGET integrated database retrieval system