KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_838Help
Entry
BBMN68_838        CDS       T01345                                 

Gene name
tdh1
Definition
tdh1
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBMN68_838 (tdh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBMN68_838 (tdh1)
  Lipid metabolism
   00071 Fatty acid degradation
    BBMN68_838 (tdh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBMN68_838 (tdh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBMN68_838 (tdh1)
   00626 Naphthalene degradation
    BBMN68_838 (tdh1)
Enzymes [BR:blb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBMN68_838 (tdh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(963788..964831)
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAALQQDDDIVIRMVRTCVCGSDLWFFRGLSGQAAHSQ
VGHEAIGVVEETGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDI
DGGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagccgcgattttcgttgagcctggcaagatgaccgtggaagaa
gtgccaaaggcggcacttcagcaggatgatgacatcgtgattcgcatggtgcgcacctgt
gtatgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagtcag
gtgggccacgaagccattggcgtggtcgaggagactggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacgggggctacttctccgcttgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgaacagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacacagccgtggtcatgggcgatggtgca
gtcggcctgtgcggtgtgattgccgccaagatgcgtggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggtggctatggtgcggac
gcggtgctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggtctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactacgatatt
gacggtggtctgctggatgcggtgcttaaaggcgagattaaccctggccgcgtgttcacc
gccgaatatgacctcgaccatattcaggacgcttatgaggccatggaccagcgcaaagtt
attaaggcgttgatccggttctaa

DBGET integrated database retrieval system