KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0052Help
Entry
Balac_0052        CDS       T00923                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blc00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:blc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53714..55240
Genome map
AA seq 508 aa AA seqDB search
MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGIYPDYTFQMMEGYGCS
LTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDYSLSEYQAVEDPLADPE
LETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEG
DVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAAATSWDSC
LWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAIEHIDEFMSDPEAAKEVGGF
AYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVTMLDMTDEQIEALPDGDYKTM
VQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIVDRQGGPRHTPGGFAAPIVAED
DGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEAVSARNADGSIGVVLLNQAERDI
PVNIRMGGLLVADVPLPARTLSTLVFTE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggcgctcaagaccactgtgcactacgatgtgaccgccgggcgaacccatacc
gagcagacggagctctcggtcatggacgaggcgatgaacaccgagcacatcgtcgaatcg
aatgtggtgggaatctacccggactacacgttccagatgatggagggctatggttgctcg
ctcaccgagtcggcatgctatctgctctccaaaatggactccgcgacgcgcaaagaggcc
ttggcccaatggttcggtcccgctggaatggacgcttggttcgtccgcgtacacatcgac
tcctgtgattactcgctcagtgagtaccaggccgttgaggatcctctggccgatcccgaa
ttggagaccttctcgattgaccgtgatcgtcagtacattcttccggtgctcaaagaggcg
atggccatggcggggcatcccattcatgtgttgctctccccatggtcgcctccggcgcaa
tggaagacgcccccggagatgacgcggaacgacgcctcggtgtacggcggcgaggagggc
gatgtcatcgatctgagcaagccggggcgctgtttcggcggaaggctcaagccggaatac
tattcgtcgtgggcgcggtacctcgtcagattcatcagcgcctatatggccgaaggtgtt
ccggtgacgatgctgtcgattcagaacgaggcggctgcggccacgagttgggatagctgc
ctgtggaccggagatcaggagcgcgaattcctgaagcaccatctctacccggcaatggag
gaggccggtctgaccgatgccgtgaagatcttcatctgggatcataacaaggaacgtgca
atcgaacacatcgacgagttcatgagcgacccggaggcggcgaaggaggttggcggtttc
gcttatcactggtactccggcgaccatttcgaggcgctgtcgatgttgcgaggcaagtat
cccgacaaggtgctgatgcattccgaaagctgtgggctgcatatacccggcaaggtgacc
atgctcgatatgaccgatgaacagatcgaggcgctgcccgatggcgactacaagaccatg
gtgcagacgaccactccgaacgagatggacttcaatgatgcgacggcctatgcccacgac
atcatcggcgacctgaaccatggaatgcagcggtggatcgactggaacatgatcgtcgac
aggcagggtggtccccgtcataccccagggggtttcgccgcgccgatcgtcgccgaagac
gacggacggtatacgctgaccatcagctaccggtatattcgcgagattgcacaggccatc
aaaccgaatgcggtggttctcggcacaagcacgtattcgcgtgatatcgaggcggtctcg
gcccgcaacgcagatggctcaatcggcgtcgtcctccttaatcaggcggagcgcgatatc
ccggtgaacattcgcatgggcggcctgcttgtggcggatgtgccgttgccggcacgcacc
ttgagtactctggtgttcacggagtga

DBGET integrated database retrieval system