KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0125Help
Entry
Balac_0125        CDS       T00923                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
blc00010  Glycolysis / Gluconeogenesis
blc00071  Fatty acid degradation
blc00350  Tyrosine metabolism
blc00625  Chloroalkane and chloroalkene degradation
blc00626  Naphthalene degradation
blc01100  Metabolic pathways
blc01110  Biosynthesis of secondary metabolites
blc01120  Microbial metabolism in diverse environments
blc01130  Biosynthesis of antibiotics
blc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balac_0125
  Lipid metabolism
   00071 Fatty acid degradation
    Balac_0125
  Amino acid metabolism
   00350 Tyrosine metabolism
    Balac_0125
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Balac_0125
   00626 Naphthalene degradation
    Balac_0125
Enzymes [BR:blc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Balac_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACS45519
Position
complement(138893..139951)
Genome map
AA seq 352 aa AA seqDB search
MAENMMKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGSDLWWFRGISERPHNT
LVGHEAIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGYDGNCFNMEPGGNAGYQ
AEYMRATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYHAAWSSRIEPGDTVVIYG
DGAVGLCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIVPERGDEAVARIMEMTNGA
GADRVLECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDVNALFWRNVSLTGGIASVAT
HDKSTLLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGRRAIKSMIDIAEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacatgatgaaagccgcggtgttcgtggaacccgaacacgtcggagtgcgc
gaagtggagcgcccgagaatcgagaagcccaccgacgcgattgtgcgcgtgctcaaggca
tgcgtatgcggctcggatctgtggtggttccgcggcatctcggagcgcccgcacaacacg
ctcgtgggccacgaggcgatcggcatcatcgacgaggtgggcgccgacgtgcacgacatg
aagcccggcgacttcgtgatcgttcccttcacccactgctgcgggcactgcgaggcctgc
gagaagggatacgacggcaactgcttcaacatggagcccggcggcaatgccggctaccag
gccgaatacatgcgcgccacctgggcaggcaccgcgctcatcaagattccgggtacgccc
gccgactacaccgacgagcagatcgcctcgctgctggcgctctcggacgtcatggcgacc
ggctatcacgccgcgtggagctcgaggatcgaacccggcgacaccgtggtgatctacggg
gacggcgccgtgggcctgtgcgcggtgatcggtgcgaagctgcttggcgctggcaggatc
atcatgatgagccgtcatgaggatcgtgcggcacttgcccgtgaattcggcgcgaccgac
atcgttcccgagcgcggcgacgaggcggtggcccgcatcatggagatgacgaacggcgcg
ggcgccgaccgcgtgctcgaatgcgtcggttccgagcagagcattgaatccgccgtgcgc
agcggacgcccgggtgcctatgtgagccgcgtcggcgtgccacatgacaacagcatcgac
gtgaacgcgctgttctggcgcaatgtatcgctgaccggcggcatcgcctcggtggccacg
cacgacaagagcacactgctcaaggccgtgctcgacggcgaaatcaacccgggcaaggtg
ttcaccgcctccttcgacctcgaccatgtgcagcaggcctatgaggcgatggacggacgc
cgtgccatcaagtcgatgatcgacatcgccgaagcgtaa

DBGET integrated database retrieval system