KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0138Help
Entry
Balac_0138        CDS       T00923                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154489..156009
Genome map
AA seq 506 aa AA seqDB search
MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTPFDGADAGFDPIDHTK
VDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGEDSEYYPMFLTMSSVFP
DGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDIDTDSAKGWEYLMSIFDQ
MSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEGAKRGLEILIEVHSYYKKQ
VEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGRDINRHYYTTSEIDKNLERPVV
KALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFGSSATLTFTPSKGMGVENPQSVA
TLVWTDSTGEHRTDDLIANPPVMQAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagttcagctgatcacctatgcggatcgcttgggtgacggcaaccttgct
tcgatgaccgacattctgcgcacgcgattcgacggcgtgtacgagggcgtgcacattctg
ccgttcttcaccccgttcgatggcgcggacgcaggcttcgacccgatcgaccacaccaag
gtcgacgcccgcctcggtgactgggatgacatcgccgagctcgccaagacgcatgacatc
atggtcgatgccatcgtcaaccacatgagctggcagtccaagcagttccaggatgtgctc
gcgaacggcgaggattccgagtactacccgatgttcctcacgatgagctccgtgttcccc
gacggcgcgaccgaggaggagctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacagcttcgccggcaagacccgcttggtgtgggtcacgttcacgccgcagcag
gtcgacattgacaccgactccgccaagggctgggaatacctgatgtcgatcttcgaccag
atgagcaagtcgcacgtcaagtacattcgcctcgacgccgtcggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagaccttcgaactcatctcgcgactgcgcgag
gagggtgccaagcgcggtctggagattctcatcgaggtgcactcgtactacaagaagcag
gtggagatcgccgccaaggtggatcgcgtctatgacttcgcgctgccgccattgctgctg
cactcgctgttcaccggcaaggtggacgcgctcgcgcactggaccgagattcgcccgaac
aatgcggtcaccgtgctcgacacgcacgacggcatcggcgtcatcgacatcggctccgac
cagctcgaccgttcgctcaagggtctggtgcccgacgcggacgtcgacaacatggtcgag
acgatcgcgaagaacacccatggcgagtcgaaggccgcaaccggcgccgccgcttcgaac
ctcgacctctaccaggtgaactccacatattattcggcgctcggctgcaatgaccagcat
tacattgccgcacgcgccgtgcagttcttcctgccgggcgttccgcaggtgtactatgtg
ggcgcgctcgccggcgagaacgacatggagctgctcaagcgcacgaatgtgggccgcgac
atcaaccgccactattacacgacctccgagatcgacaagaacctcgaacgtccggtggtc
aaggccctgaacgcgctcgccagattccgcaacgagctgccggcgttcgacggcgacttc
agctactcggtgggcgatgacgagtcgattgcgttctcctggaacggtttcggatcctcc
gctacgctcacgttcacgccgtccaagggcatgggtgtcgagaacccacagtccgtcgcc
acgctcgtctggacggattccactggcgagcaccgcaccgacgacctcattgcgaacccg
cccgtcatgcaggcgagctga

DBGET integrated database retrieval system