KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0212Help
Entry
Balac_0212        CDS       T00923                                 

Definition
(GenBank) recombination protein recR
  KO
K06187  
recombination protein RecR
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Balac_0212
DNA repair and recombination proteins [BR:blc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Balac_0212
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Balac_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
247788..248390
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccatccagcggctcatcgactcgtttgcgagtctgccg
ggcatagggcccaaaggagcgcaacgcatcgccttctatctgctgcaggcgccggatgcg
gagtcgcagcgcctcgtcgacgcaatcaacgaggtgaaggagaaagtacggttctgcgaa
gtctgcgggaatgtgtgcgaaagcagcccgtgcacaatctgctcggatccgcgtcgtgat
cacggcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgtcggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
atcatcgtggcgctcaatccgaacatcgagggggaggcaaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgagtacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system