KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0268Help
Entry
Balac_0268        CDS       T00923                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Balac_0268
  Lipid metabolism
   00600 Sphingolipid metabolism
    Balac_0268
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Balac_0268
Enzymes [BR:blc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Balac_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328532..331990
Genome map
AA seq 1152 aa AA seqDB search
MFIPRYFEDLDTLHVGCEPNRAYFVPASAPTDTRFAAREQSDRFRLLNGEWDFKYYASVY
DLDAEVDASAQAHEPVFTEPMFDADSYDQIAVPSVWQTHGYDHNQYTNTRYPFPLDPPFV
PHDNPCAVYRTTFGYDVDPACPRAFLNFEGVDSCFYVWLNGDFVGYSQVSHSTSEFEVTD
ALDDGENTLVVLVLKWCDGSYLEDQDKFRMSGIFRDVYLLTRPEHAIRDFYVRTDIRFAD
SGTRAAAAPQAVSADVTVDFDFLDGVPVEGIDVVIGDAAGNVVAQGVTEAVQSETGTVGE
SAHRRQAVENGSAFPAKARVKLTVEQPVLWNPEVPTCYTLMILSDGESITQPLALRDIAV
VAPDGRHQTVLLNRRPIVIHGMNRHDSDPVTGYTISPEQFRTDLLLMKSHNVNGVRTSHY
PNAPHYYDLFDELGFLVIDEADIEAHGVADAVLPKPGAESANMEEWQRAQLMWNGLIANN
PRFVPAILDRIQRLVERDKNRGCVIFWSMGNESAYGIGFEKALEWVKTLDSQRLTHYESA
RYVEEGGTLQHDYGNIDVHSRMYPSIAEIDAYFSESGPNGDGANGEDGTAENGQVKPYIM
CEYCHAMGNGPGDLEDYFQCIERHEGLLGGYIWEWCDHAIYAGRNARGRQEYLYGGDFGE
WPNDGNFCVDGMVSPDRTPHSGLDEFKNVFRPARVVSVDAERGVVNLRNHYDFRELGEAV
IVMWEVYVDGVMQTYSLVEPGTFAIEPHAVGEVRLSGWESVWPVAQPGRVTLVLRYLARE
AQWGQEQLFELGFDEVELPNPTGDNSSQWVRHQVEDMLAGDEIGESVTLEESDARIVING
ANWRYVFDKCTGLFSELVYANRTILATPMTLDIWRAPTDNDRNVRHEWERCGYDRAYARA
YDVQTRTVVSSGIGEAALGVDGGAYGEETAVEDAEGPMAVNAVEIKCSMGAVAPTVQPIA
RMDTTWTVHADGSVALHMNVRKDPAFPFLPRFGIHMQLLKSMSNVTYCGLGPNESYVDKR
RASWHGVFSASVSQMGEREIKPQENGNHHDCSWARVQGDGVALMIVQGDGSQPESPAELL
RGFDFQALEYTAAEMTRARHDFELQPSGFTEVSVDYMQSGIGSNSCGPELLPQYRLDAPE
FDFAITLRPQLA
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
gtgttcattccgcggtatttcgaggatcttgatacgttgcatgtggggtgcgagccgaat
cgcgcgtatttcgtgccggcgtcggcgcccaccgatacgcggttcgccgcgcgcgagcaa
tccgatcgattccgtctgctcaacggcgagtgggatttcaaatactatgcgagcgtctac
gatttggacgcggaggtggacgcaagcgctcaagctcacgagccggtgttcaccgaaccg
atgttcgacgcggactcctatgaccagatcgccgtgccgagcgtgtggcagacgcacggc
tacgaccacaaccagtacacgaacacgcgctacccgttcccgctcgacccgccgttcgtg
ccgcacgataacccgtgcgcggtgtaccgcacgaccttcggctatgacgtggatcccgcc
tgcccgcgcgccttcctgaatttcgagggtgtggacagctgcttctacgtgtggctcaac
ggcgacttcgtaggctattcgcaggtctcgcattcgacgagcgagttcgaggtgactgac
gcgcttgacgacggcgagaacacgctcgtcgtgctcgtgctcaaatggtgcgacggcagt
tacctggaggatcaggacaagttccgcatgagcggcatcttccgcgatgtgtacttgctc
acgcgccccgaacatgcgattcgtgatttctatgtgcgcaccgatatccggtttgcagat
tccggcacgcgtgcggcggccgcgccgcaggccgtgagcgcggacgtgaccgtcgacttc
gacttcctcgacggcgtgccggtggagggcatcgacgtcgtgatcggcgacgcggcgggc
aatgtggttgcgcagggcgtgacggaagcggttcagtctgaaacgggcacggtgggggag
tctgcccaccgaaggcaagcggttgagaacggcagcgcattcccggcgaaggcgcgcgtg
aaactcaccgtggaacaacccgtgctgtggaatccggaggtgccgacctgctacacgctg
atgattctgagcgacggcgaaagcatcacgcaaccgcttgcgctgcgcgacatcgccgtc
gtggcgcccgacggccgccaccagaccgtgctgctcaatcgcaggccgattgtgatccac
ggcatgaaccggcacgacagcgacccggtgaccggttatacgatctcgccggagcagttc
cgaaccgatctgctgctcatgaagagccacaacgtgaacggcgtgcgcaccagccactac
ccgaacgcgccgcattactacgatctgttcgacgagctcgggttcctcgtgatcgacgag
gccgacatcgaggcgcatggtgtggccgacgccgtgttgccgaagcccggcgcggaatct
gcgaatatggaggaatggcagcgcgcgcagctcatgtggaacggcctcatcgcgaacaat
ccgcggttcgtgccggccattctcgaccgcattcagcgcctcgtggaacgcgacaagaac
cgtggatgcgtgatcttctggtcgatgggcaacgagtccgcctacggcatcgggttcgaa
aaagcgcttgagtgggtgaaaacactggattcgcagcggctcacccattacgagagcgcg
cggtatgtcgaagaaggcggaacgcttcagcatgactacggcaacatagacgtgcacagc
cgcatgtacccgagcatcgccgagatcgacgcgtatttcagtgaatccgggccgaacggg
gacggtgcgaatggggaggacggcaccgcggaaaacgggcaggtgaagccctacatcatg
tgcgagtactgccatgccatgggcaacgggccgggcgatctcgaggactacttccagtgc
atcgagcggcacgaggggctgctcggcgggtacatatgggaatggtgcgaccacgcgatc
tacgccggcaggaacgcgcgcgggcggcaggaatacctgtacggcggcgacttcggcgaa
tggccgaacgacggcaatttctgcgtggacggcatggtttcgccggaccgcacgccgcac
agcggcctcgacgagttcaagaacgtgttccggccggcgcgcgtggtgagcgtggatgcc
gagcgcggcgtggtgaatctgcggaaccattacgacttccgcgagcttggtgaagcggtt
atcgtgatgtgggaagtgtatgtggacggcgtgatgcagacgtacagcctcgtcgagccg
ggcacgttcgcgattgagccgcatgcggtgggcgaagtgcgcttaagcggttgggagagc
gtgtggccggtcgcgcagcccgggcgagtcaccctcgtgctgcggtacttggcgcgcgag
gcgcagtgggggcaggagcagctgttcgaactcggcttcgacgaggtggagttgccgaat
ccgaccggagataacagttcgcagtgggtgcgtcaccaggtggaagacatgctcgccggc
gacgagataggcgagtcggtgacgttggaggaatccgatgcgcgcattgtgatcaacggc
gcgaactggcggtacgtgttcgacaagtgcaccggtttgttcagcgagctcgtgtacgcg
aaccgcacgattctcgcgacgccgatgaccctcgacatctggcgtgcgcccaccgacaac
gaccgcaatgtgcggcatgagtgggagcgctgcgggtacgaccgcgcatatgcgcgcgcg
tacgacgtgcagacgcgcaccgtggtctccagcggcattggcgaagcggcgctcggcgtg
gacggcggcgcgtacggcgaagagacggccgtggaggacgccgaggggccgatggcggtg
aacgcggtggaaatcaagtgctcgatgggggcggtcgcgcccacggtgcagccgatcgcc
cgcatggacaccacgtggacggtgcatgcagacggttccgtagcgcttcacatgaacgtg
cgcaaggatccggcgttcccgttcctgccgagatttggcattcacatgcaactgctgaaa
tccatgagcaacgtcacctattgcggcctcgggccgaacgaaagctatgtggacaagcgg
cgcgccagctggcacggcgtcttcagcgcttcagtgagccagatgggcgaacgcgagatc
aaaccgcaggagaacggcaaccaccacgattgcagctgggcgagagtgcagggtgacggg
gtggcgttgatgattgtgcagggcgacggctcgcagcccgagagtcccgcggaactgttg
cgcgggttcgatttccaggcgttggaatacacggcggccgagatgacgcgcgcacggcac
gatttcgagctgcagccgagcgggttcaccgaagtgagtgtggactacatgcagtccggc
atcggttcgaacagctgcgggccggagctgctgccgcaataccgcctcgatgcgccggaa
ttcgacttcgccatcacactgcgtccgcagctcgcctga

DBGET integrated database retrieval system