KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0378Help
Entry
Balac_0378        CDS       T00923                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Balac_0378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balac_0378
   00620 Pyruvate metabolism
    Balac_0378
   00650 Butanoate metabolism
    Balac_0378
  Lipid metabolism
   00071 Fatty acid degradation
    Balac_0378
  Amino acid metabolism
   00350 Tyrosine metabolism
    Balac_0378
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Balac_0378
   00626 Naphthalene degradation
    Balac_0378
Enzymes [BR:blc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Balac_0378
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Balac_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463598..466345
Genome map
AA seq 915 aa AA seqDB search
MADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVRKAQKALAEFEKLDQQAVDRIVAKA
SVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACEHVTNYMAGQKTVGIIREDDVLGID
EVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKSSVEAARIVRDAAI
EAGAPENCVQWIEHPSIEATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAP
AYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIAHKDIYAPLVKELKRRKAYFVNDEE
KAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHEAGFEIPEDATILAAECSEVGENEP
LTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHTAAIHTNNDDLVREYGLRMHACRII
WNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGNVQAINLLNIKRIARRNNNMQWFKI
PAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIVDYVE
PEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAAKIMWLLYEHPEIAFSDVREKFFDI
RKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDP
VLARTQPRRLASDAGFDALTHSMEAYVSVYANDFTDGMALHACKLIWDNLAESVNSEPGE
TKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHIAHGRTNSILLPYVIRYNGQ
VPEEPTSWPKYSKYIAPERYQELASLLGVDPGKTPAEGVENLAKAVEDYRDNKLGMNKSF
KDCGVDEDYFWSILEQIGMRAYEDQCAPANPRIPQIQDMMDIAIAAYYGVSQAEGHAMRV
EREGVGATEEASERV
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagaacagcgccgagaccgcaacgaaggcggccaagcttgctgtgaatgtg
gaagacaagaaggccgcggcacaggccgaggtcgacgctctggtcaggaaggcgcagaag
gcgctggcggaattcgaaaagctcgatcagcaggccgtcgatcgcatcgtggcgaaggcc
tccgtggccgccctcaacaagcatctggtgctggcgaaactggcagtcgacgagaccggt
cgtggactcgtcgaagacaaggcgacgaagaacatcttcgcctgcgagcacgtgaccaat
tacatggccggtcagaaaaccgtcggcatcatccgcgaagacgacgtgctcggcatcgac
gaagtggcagaaccggtcggcgtcgtcgcaggcgtcaccccggtgaccaacccgacgtcc
actgccatcttcaagtcgctcatcgccctcaagacccgttgcccgattgtcttcggcttc
cacccgggagcgcagaagagctccgtcgaagcggcgcgcatcgtgcgtgacgccgccatc
gaggcaggtgccccggagaactgcgtgcagtggatcgaacacccgtccatcgaggcgacc
ggcgcgctcatgcagcatcccggcgtggccacgatcctcgcgaccggcggccccggcatg
gtcaaggccgcgtactcgtccggcaagccggccctgggcgtcggcgccggcaatgccccg
gcctacgtcgacaacaacgtcgacgtgcagcgcgtggcgaacgacctcatcctctcgaag
cacttcgactacggcatgatctgcgccaccgagcaggcgatcatcgcgcacaaggacatc
tacgcaccgctcgtcaaggaattgaagcgccgcaaggcatacttcgtcaacgacgaggag
aaggccaagctcgagaagtacatgttcggctgcaccgcgttctccggcgagaccccgaag
ctcaactccgtggtcccgggcaagtctccgcagtacatcgcgcacgaagccggcttcgaa
atccccgaggacgccacgatcctcgctgccgaatgctccgaggtgggcgagaacgagccg
ctcaccatggagaagctggcgccggtgcacgccgtgcttaagttctccgacaaggagcag
ggcttcgaaatgtgcgaggagatgctcaagcacggtgccggccataccgccgcaatccac
acgaacaacgacgacctcgtccgcgagtacggcctgcgcatgcacgcctgccgcatcatc
tggaaccagccgagctcgctcggcggcattggcgacatctacaactccatcgccccgtcg
ctcacgctgggctgcggttcctacggtggcaactccgtctccggcaacgtgcaggcgatc
aatctgctcaacatcaagcgaatcgcgcgaaggaacaacaacatgcagtggttcaagatc
ccggcaaagacgtacttcgagccgaacgccatcaagtacctgcgcgacatgtatggcatc
gagcgtgccgtcatcgtgtgtgacaaggtgatggagcagctcggcatcgtcgacaaggtg
attgaccagctgcgtgcacgctccaaccgagtcaccttccgcatcgtcgactatgtggag
cccgagccgagtgtcgagaccgtcgagcgcggcgccgccatgatgcgcgacgaattcgag
ccggacacgatcatcgccgtcggcggtggctctcccatggacgccgcgaagatcatgtgg
ctgctctatgagcacccggaaatcgcgttctccgacgtgcgtgagaagttcttcgacatt
cgcaagcgcgctttcaagattccgccgctcggcaccaaggccaagcttgtgtgcatcccg
acctcgtcgggcaccggctccgaggtcacgccgttcgctgtgatcaccgaccacaagacc
ggctacaagtacccgatcaccgactacgcgctcacgccgtccgtcgcgatcgtcgacccg
gtgctcgcgcgcacgcagccgcgccgactggcctccgatgccggcttcgatgcgctgacc
cattcgatggaggcctacgtctccgtctatgcgaacgacttcaccgacggtatggcgctg
catgcctgcaagctgatctgggacaaccttgcggagtccgtcaatagcgagccgggcgaa
accaagaagaaggcgcaggagaagatgcacaacgccgccaccatggccggcatggcattc
ggatccgccttcctcggtatgtgccacgccatggcgcacaccatcggcgccctgtgccac
atcgcgcacggccgcacgaactcgattctgctgccatatgtgatccgctacaacgggcag
gtgccggaggagccgacctcctggccgaagtacagcaagtacatcgcgccggagcgttac
caggagctcgcctcgctgctcggggtcgacccaggcaagaccccggccgagggtgtcgag
aatctggcgaaggccgtcgaggactaccgcgacaataagctcggcatgaacaagagcttc
aaggattgcggtgtggatgaggactacttctggagcatcctcgagcagatcggcatgcgc
gcctatgaagaccagtgcgcgcctgcgaatccgcgcatcccgcagatccaggacatgatg
gatatcgccatcgccgcctactacggcgtctcgcaggcggagggccatgcgatgcgcgtt
gagcgcgaaggcgtgggcgccacggaggaagcctccgagcgcgtctga

DBGET integrated database retrieval system