KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0458Help
Entry
Balac_0458        CDS       T00923                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Balac_0458
   00670 One carbon pool by folate
    Balac_0458
Enzymes [BR:blc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Balac_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545653..546336
Genome map
AA seq 227 aa AA seqDB search
MESGSSRSGYHEPVPGSAGPEVFEDDWGDDFPKTFSVNLIWAQANDKEGRSGAIGYEGEM
PWHLPEDLKRFKELTVSHPVIMGRKTWEALNEKFRPLPNRDNIVLSRDRDFRAPGATVVD
NLEEALDMARQEAIPDDGLDRSEIWVIGGSQLFNQMLPMASKIYMTQVDAKVNADAYAPD
LTEALNNGSWKLMENSGWLTPKKPEGIDRYRYLTFERNTGDEQAEEE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggaagtagccgcagtggctatcacgaacccgtgcccggatccgccgggcca
gaagtcttcgaggatgactggggagatgatttccccaagacgttctcggtgaatctcata
tgggcacaggcaaacgacaaggaaggccgttccggtgccattgggtatgagggtgagatg
ccctggcatctgcctgaagacctgaagcgattcaaggagctcaccgtctcccatccggtg
atcatggggcgcaagacctgggaggcgctcaacgagaagttccggccgcttccgaaccgt
gacaacatcgtgttgtcgcgtgaccgtgatttccgtgcgccgggtgccaccgtggtggac
aatctggaggaggcgctcgatatggcccgtcaggaggccattcccgacgacggactcgac
cgcagcgagatctgggtcatcggcggctcccagctgttcaaccagatgttgccaatggca
tccaagatctacatgacgcaggtcgacgccaaggtgaatgcggacgcctacgctccagac
ctcaccgaggcgctcaacaacggttcctggaaactcatggagaattcgggatggctcacg
ccgaagaagcccgaaggcatcgatcgttaccgttacctgacgttcgaacgcaataccggc
gacgaacaggccgaagaggaataa

DBGET integrated database retrieval system