KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0476Help
Entry
Balac_0476        CDS       T00923                                 

Gene name
lacZ
Definition
LacZ
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blc00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blc00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:blc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566960..570163
Genome map
AA seq 1067 aa AA seqDB search
MNEETLQEVAEEKATEPPRNDVPSTDGALRSEEPTAAWLTDPRVFAVNRLPGHTDHNCAD
DQSGALKQHLDGEWAVKVVPSHLDRLPTEGLDEHWQHAHLPPEFASRSFADGDFTRVQVP
GCLEMQGLMRPQYVNIQYPWDGHENPQAPSVPTDNLVALYRRAFTADDRVGEALSRGERV
SLTFHGAATAIYVWLNGVFVGYAEDSYTPSEFDVTEALHAGENLLAVACFQYSSASWLED
QDCWRFHGLFRDVELEVRPHAHVRDMLAHADWNVDAQCGELAVELDLDGAWCAANVELRL
STWEEHADGAALLWSATVESAPKIRYATTCEQVLPWSAEQPNLYVLEAVVRDANGRVLET
ARTRIGFRHVEIRDGVLVLNGERIVFHGVNRHEFDARRGRSVTEEDMLWDVRFMKRHNIN
AVRTSHYPNQTRWMELCDEYGLYVIDEANLETHGSWNLPGDTADGVSIPGDDVRWQPACV
DRVESMVRRDRNHACVVAWSLGNESYAGDVIRAMGNRCRELDPTRPVHYEGVTWNREYDD
ISDFESRMYAKPDEIREYLESDPAKPYISCEFMHAMGNSVGGLGEYVALERYPQYQGGFI
WDFMDQALWQRLDDGTERLAYGGDFGDRPSDYEFSGDGIVFADRTVSAKAQEVKAQYAGV
RLEPDGRGVRVTNTNAFQGTSGTVFVARMLLDGREAWSKSYEFEVAAGSARSFDIGFPDV
HSLPDGGVMHEVVYEVSQQLAHDTAWAEAGYEIAWGQAVVRPHASGRSGSKMNDAFDDDN
LQIVTLGRWNAGVRVGQREILLSRTHGGVISLRDGEREYVIRVPKLLTFRPLTDNDRGMS
SGFDRVQWFGAGRYARVVTGVGQVYRDELTGDLCGEYWYELADGAQTQVPIRYRIDSQLR
MHIELEYTGCAGAPSLPAFGLEWMLPKQYENLEFYGRGPAETYRDRKRAKLGIWNTTAQA
DMAPYLVPQETGNHEDVRWAYVFDADCHGLLVEADDSLALSLLPHSSLEIENATHQNELA
QPRHMFLRLLAGQMGVGGDDSWGAPVHDRYLLPADEPLKLAVTISML
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggagaccttgcaggaagtcgcagaggagaaggcgaccgagcccccgcgcaat
gatgtgccgtccactgatggagctctgcgatccgaagagccgacggcggcgtggctgacc
gatccccgtgtgttcgcggtcaaccggctgccggggcataccgaccacaattgcgccgac
gatcagtccggcgcgttgaagcagcacctcgacggcgaatgggcggtgaaggtggtgccc
tcgcacttggatcggctccccacggagggcttggatgagcattggcagcacgcccacctt
ccgccggaattcgcatcgcgcagcttcgccgatggcgacttcacccgtgtgcaggtgccg
gggtgtctggagatgcaggggctcatgcgtccgcaatatgtgaacatccaatatccgtgg
gatggccatgaaaatccgcaggcaccctccgttcccacagacaatctggtcgcactgtac
cggcgtgcgttcactgccgatgatcgcgtgggcgaggcgctgtcccgcggggagcgcgtg
agtctgaccttccacggtgcggcgacggcgatctacgtgtggctcaacggcgtgttcgtg
gggtacgcagaggattcctacacccccagcgagttcgatgtgaccgaggcgctgcatgcg
ggggagaatctgcttgccgtggcgtgcttccaatattcgagtgcgagttggctggaagac
caggattgctggcgtttccacggattgttccgcgacgtggagctggaggtgcgacctcac
gcccatgttcgcgacatgcttgcgcatgcggattggaatgtggatgcgcagtgcggtgag
ctcgccgtcgaactcgatctcgacggggcgtggtgtgcggccaatgtggagctgcggctc
agcacatgggaagagcacgcagacggcgcggccctgctgtggagcgcgacggtggaatct
gctccgaagatccgctacgccacgacatgcgaacaggtgctgccgtggagcgcggagcag
ccgaatctgtacgttctcgaggctgtggtgcgcgatgcgaacggtcgtgtgctggaaacc
gcgcgcacgcgcatcggattccgccatgtggagattcgcgatggcgtgcttgtgctcaat
ggcgaacgcattgtgttccatggcgtcaaccggcacgaattcgacgcgcggcgcggacgc
agcgtcaccgaggaggacatgctgtgggatgtgcggttcatgaagcggcacaacatcaat
gccgtgcgcacctcgcattacccgaatcagacgcggtggatggagctgtgcgacgaatac
ggactctatgtgatcgacgaggccaatctggagacgcatggcagctggaatctgcccggt
gacacggccgatggcgtctcgataccgggggacgacgtgcgttggcagccggcttgcgtg
gaccgtgtggagagcatggtgcgccgagaccgaaaccatgcgtgcgtggtcgcgtggtcg
ctcggcaacgaatcgtacgcgggcgatgtgatccgcgcgatggggaatcgctgccgagag
ctcgaccccacccggccggtgcactacgagggcgtgacctggaaccgtgaatacgacgac
atcagcgatttcgaatcgcgtatgtatgcgaagcccgatgagattcgcgaatacctggaa
agtgatccggcgaaaccgtacatctcctgcgaattcatgcatgcgatgggcaattcggtg
ggaggactgggtgaatacgtcgccttggagcgctacccgcaataccaaggcggcttcatc
tgggacttcatggatcaggcactatggcagcggctcgacgacggcacggaacgcctggcc
tatggcggcgatttcggcgacaggccgagtgattacgagttcagcggcgatggcattgtg
ttcgccgaccggaccgtgtcggcgaaggcgcaagaggtgaaggcacaatatgccggcgtg
cgtctcgaaccggatgggcgcggtgtgcgcgtgaccaatacgaatgcgttccaaggcacc
tcgggcaccgtgtttgtggcgcggatgcttctggacggacgtgaggcatggtcgaagagc
tatgagttcgaggtggcggccggaagcgcccgaagcttcgacatcggcttccctgacgtg
cacagtctgcccgacggtggcgtcatgcatgaggtggtgtatgaggtgagtcagcagttg
gcgcatgacaccgcctgggcggaagcggggtatgagatcgcatggggacaggccgtggtg
cgtccccatgcgagtggccgcagcgggtcgaagatgaatgatgcgttcgatgacgacaat
ctgcagatcgtcactctcgggcgatggaacgccggagtgcgtgttgggcagcgtgagatc
ctgctgtcgcgcacgcatggcggagtcatctcgttgcgcgacggtgagcgtgaatatgtg
attcgtgtgccgaaactgctcacgttccgcccgctcaccgacaacgaccgtggcatgagc
tccggtttcgaccgcgtgcagtggttcggtgccgggcggtatgcgcgcgtcgtcaccggc
gtgggccaggtgtaccgcgacgagctcaccggagatctgtgcggcgagtactggtatgag
ttggcagacggcgcgcagacgcaggtgccgattcgttatcgtatcgattcgcagttgcgc
atgcatatcgaacttgagtatacggggtgtgcgggtgcgccgagcctgccggctttcgga
ttggagtggatgctgccgaaacagtatgagaatctggaattctatggtcgggggcctgcc
gagacctaccgtgaccgcaagcgcgccaagctcggcatctggaacaccacggcgcaggcg
gacatggcgccgtatctggtgccgcaggaaaccggcaatcacgaggatgtgcgttgggcc
tatgtgtttgacgccgattgccatgggctgctcgtggaggccgacgactcgctcgcgctc
agcctgctgccgcacagttcgttggagatcgaaaatgccacacaccagaacgagttggcg
caaccacgtcatatgttcctgcgcctgctcgcagggcagatgggcgtgggcggcgacgac
tcgtggggcgctcctgttcacgatcggtatctgctgccggcagacgaaccgctcaagctg
gccgtgacaatcagcatgctctga

DBGET integrated database retrieval system