KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0690Help
Entry
Balac_0690        CDS       T00923                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:blc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blc00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813631..814401
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPKAVGDIVRQQLEHFEV
PEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QAFGAAAGQDGLVIATTLGTGIGTALIYDGVLIPNTELGHIQLPKGKGDAEKYAASSVRE
KLDMGYRKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIVGAAYYANQQSAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcattcggcgttgacatcggtggctcgggcatcaaggccgct
ccggtgaatctggagaagggcgaattcgccgaaccccgcctgaagatcctcactccagag
cattccactcccaaggctgtgggagacattgtgcgccagcagctcgagcatttcgaagtg
cccgaggacgtaccggtgggaattgcgttcccggccccgatcaagccgggtaagaagctc
gacttcatggcgaacctcgatcagtcgtggattggtgtggacgtgaccgaggtgttctcc
gaggcatgcggccgtcctgtcaccgtggtcaacgacgcggacgcggccggtctggcggaa
caggcgttcggtgcggcggcgggccaggatgggcttgtcatcgccaccaccctcggcacc
ggcatcggtaccgccctgatctacgatggcgtgctcatccccaacaccgagctcggccac
atccaactgccgaagggcaagggcgatgcggagaagtatgcggcatcctcggtccgtgag
aaactcgacatgggctacaggaagtgggccaagcgcctcaccaagtactacggtctcatg
gagctgtacttcagccccgagttgttcgtggtcggcggtggtgtgagccgcgtctccgag
aagttcctgccgtacatcgacatcaagaccccgattgtcgccgccaagctgcataacgag
gcgggcatcgtgggtgccgcctactacgccaaccagcagtcggccaagtag

DBGET integrated database retrieval system